BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M11 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 3.8 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 3.8 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 5.0 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 8.7 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 113 RLVSWTDSFNSNTHYLQ 63 R+ WTD +NSN + Q Sbjct: 499 RMKFWTDIYNSNPLFTQ 515 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 113 RLVSWTDSFNSNTHYLQ 63 R+ WTD +NSN + Q Sbjct: 501 RMKFWTDIYNSNPLFTQ 517 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 349 LPTLHLFSMXNFY 387 LPTL LF++ FY Sbjct: 161 LPTLKLFALHEFY 173 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 489 ITYSH*RVYTNIMCIYXGNIYILMLSXRISYYMWXIXLW 605 + Y H R+Y + I YI+++S + Y I L+ Sbjct: 144 LRYEHYRLYQLSVLIDNNMSYIIIVSFATNLYFIIIQLF 182 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,243 Number of Sequences: 336 Number of extensions: 3229 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -