BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M03 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 25 0.75 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 25 0.75 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 3.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 7.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 7.0 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 9.2 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 24.6 bits (51), Expect = 0.75 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 88 SIRTLSLADEMFSDTYKMKLVDEVI 162 S+ T + A+E++SD Y +DE++ Sbjct: 12 SLLTWTYAEELYSDKYDYVNIDEIL 36 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 24.6 bits (51), Expect = 0.75 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 88 SIRTLSLADEMFSDTYKMKLVDEVI 162 S+ T + A+E++SD Y +DE++ Sbjct: 12 SLLTWTYAEELYSDKYDYVNIDEIL 36 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/24 (37%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 538 KVXIFH-HGNHAITIHRLPSKELK 470 K+ +F H N IT++R P + K Sbjct: 151 KIHVFSLHDNKLITMYRFPQNQFK 174 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -2 Query: 116 SSASDNVLIDLHFDGLEAIKNNKNRKNGFSPQQLNRE 6 +SAS+ + + L + +N F+ Q+L+RE Sbjct: 611 ASASEESVHSMELRTLPCLLPRPKSENNFASQELSRE 647 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -2 Query: 116 SSASDNVLIDLHFDGLEAIKNNKNRKNGFSPQQLNRE 6 +SAS+ + + L + +N F+ Q+L+RE Sbjct: 579 ASASEESVHSMELRTLPCLLPRPKSENNFASQELSRE 615 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/31 (35%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +2 Query: 242 ADEGTDSAVESG-VDIVLNHRLVETYAFGDK 331 +DE +A++SG + +N+ L++T +GDK Sbjct: 44 SDEKRQAAIQSGDYNYTMNY-LLDTDQWGDK 73 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,357 Number of Sequences: 438 Number of extensions: 3012 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -