BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_L11 (469 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 24 2.3 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.3 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 22 9.3 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.3 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 49 LNQHSSFYTCA-IARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDS 189 L SS C I+R + E+G + G CC +W W ++S Sbjct: 53 LTAQSSHTKCIPISRNASAIGENGVA-LKKGLPHVICCRLWRWPDLNS 99 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 5.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 207 STGATNGVNRPP 172 STG++N NRPP Sbjct: 1627 STGSSNSCNRPP 1638 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.2 bits (45), Expect = 9.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 394 NRKGPILERCRE 359 NR GP ERC+E Sbjct: 373 NRDGPNCERCKE 384 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 440,545 Number of Sequences: 2352 Number of extensions: 8888 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -