BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fe100P02_F_L11
(469 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 24 2.3
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.3
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 22 9.3
>AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein.
Length = 506
Score = 24.2 bits (50), Expect = 2.3
Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
Frame = +1
Query: 49 LNQHSSFYTCA-IARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDS 189
L SS C I+R + E+G + G CC +W W ++S
Sbjct: 53 LTAQSSHTKCIPISRNASAIGENGVA-LKKGLPHVICCRLWRWPDLNS 99
>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
Length = 3398
Score = 23.0 bits (47), Expect = 5.3
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = -2
Query: 207 STGATNGVNRPP 172
STG++N NRPP
Sbjct: 1627 STGSSNSCNRPP 1638
>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
precursor protein.
Length = 1623
Score = 22.2 bits (45), Expect = 9.3
Identities = 8/12 (66%), Positives = 9/12 (75%)
Frame = -1
Query: 394 NRKGPILERCRE 359
NR GP ERC+E
Sbjct: 373 NRDGPNCERCKE 384
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 440,545
Number of Sequences: 2352
Number of extensions: 8888
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 40820256
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -