BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_L05 (616 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 6.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.2 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 258 CVSKEAGHQTSAESW 302 C K+ GH+ S SW Sbjct: 1152 CEEKKPGHKPSTSSW 1166 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 191 AHTSGPGQ*CSRFYVQELEAALLREQGGWSPNQCRIMGYR 310 A TSG G+ FY+ E + + G S N I +R Sbjct: 1376 AQTSGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFR 1415 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 191 AHTSGPGQ*CSRFYVQELEAALLREQGGWSPNQCRIMGYR 310 A TSG G+ FY+ E + + G S N I +R Sbjct: 1376 AQTSGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFR 1415 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 173 PVRIQGAHTSGPGQ*CSRFYVQELEAAL 256 PVRI G H G C++ E AL Sbjct: 196 PVRIMGVHRPGFDNDCNKNTSTSKEIAL 223 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 284 NQCRIMGYRTCCCPN 328 +Q R G TC CPN Sbjct: 281 SQRRYTGRATCDCPN 295 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,318 Number of Sequences: 336 Number of extensions: 3091 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -