BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K23 (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 158 3e-39 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.77 SB_8510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 30 1.8 SB_10831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) 29 4.1 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 5.4 SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 5.4 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 28 7.1 SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) 28 7.1 SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) 28 7.1 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 9.4 SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) 27 9.4 SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) 27 9.4 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 158 bits (384), Expect = 3e-39 Identities = 77/116 (66%), Positives = 95/116 (81%) Frame = +1 Query: 22 TMSTKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIY 201 T S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+ Sbjct: 6 TASAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIF 65 Query: 202 VPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 369 VP+P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 66 VPVPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 62.5 bits (145), Expect = 3e-10 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 482 HLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFP 583 HLDK QQTTI+HK++TF +VYKKLTG++V FEFP Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 0.77 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Frame = +1 Query: 112 NSDLKAQLRELYITKAKEIE---LHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFS-- 276 + + K L+E+ I ++K+ E + + KS PKLKA Q + + KK Sbjct: 261 HEEKKEDLKEVVIKQSKQDEATAIKDSKSESKPASKPKLKAVQNDAPKKANKPAKKAKKP 320 Query: 277 ---GKHVVFVGDRKILPKPSHKTRVANKQKRPRS 369 K V+ LP+ +H+ AN Q+RP++ Sbjct: 321 VKRAKKVLNKKKMDTLPRGAHRPASANAQRRPQN 354 >SB_8510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -1 Query: 567 TSRPVSFLYTDWKVSTLCSIVVCWFLSKCTLMSCEPSNLXPDALAYDLSRE 415 T+R ++ ++DW ++ C CW +S T+ S +N+ AY SRE Sbjct: 120 TNRCGAYYHSDWLIAIPCRRRACWTVSLITIFSQVLTNIKVPIPAY--SRE 168 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.9 bits (64), Expect = 1.8 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 5/128 (3%) Frame = +1 Query: 37 IIKASGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHNKKSIIIYV 204 ++++SG +S E+ + E N+ LK +L E L +T+ +E E+ N K + +YV Sbjct: 1681 VLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-NDKLMALYV 1734 Query: 205 PMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILP-KPSHKTRVANKQKRPRSXTLT 381 M KL++ Q ELEK+ ++ ++I P K S T VA + + Sbjct: 1735 NMSKLESTQGTLEEKNAELEKE------LYSAQQEIQPLKDSFNTAVAENESLVKELNEA 1788 Query: 382 SVYNAILE 405 + N LE Sbjct: 1789 NNKNIKLE 1796 >SB_10831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -1 Query: 588 GSG-NSKVTSRPVSFLYTDWKVSTLCSIVVCWFLSKCTLMSCEPSNLXPDALAYDLSRED 412 G+G N++ F DWK+S +++ S+ L +C ++ P A A DLS Sbjct: 391 GTGKNARGIQNLFVFPVDDWKISHDALLILTNHTSESWLFACNGASGHPCATAVDLSHFA 450 Query: 411 QVL 403 Q+L Sbjct: 451 QLL 453 >SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) Length = 237 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 351 FVSNTSFVAGLRQDLTVSNKDYMFTTE 271 F+ N SFV+ + DLT S+ D+ + TE Sbjct: 40 FIPNLSFVSAVLWDLTKSSSDFQWHTE 66 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 64 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 231 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 28.3 bits (60), Expect = 5.4 Identities = 22/120 (18%), Positives = 57/120 (47%), Gaps = 8/120 (6%) Frame = +1 Query: 55 AEADSFETSISQALVELETNSDLKAQLRELYITKAKEI-----ELHNKKSIIIYVPMPKL 219 A+ + + Q E++T+ + K +RE ITK K + E +++++ + K+ Sbjct: 237 AQRKTLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKDELDKV 296 Query: 220 KAFQKIQIRLVRELEKKF---SGKHVVFVGDRKILPKPSHKTRVANKQKRPRSXTLTSVY 390 + + + +RE+E++F K+ + +R++ + K + Q+ + + +V+ Sbjct: 297 AKLYEEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKKRQQELVQRNYAAVRIQAVW 356 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 116 PTSKPNFGSFTLQKLKKLNYTIRS 187 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -1 Query: 321 LRQDLTVSNKDYMFTTELLFELTDKPDLDLLKGLQFRHRHIDDDRLL 181 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 170 LRQRLNSSNPSISSPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 216 >SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) Length = 227 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 516 CSIVVCWFLSKCTLMSCEPSNLXPDALAYDLSREDQVLEDSIVHRGQ 376 C V+ W CTL S P+ L A D+SR +L D + G+ Sbjct: 149 CRTVLAWLDQHCTLPSLRPAVL---AALRDISRTTSILTDPSLVPGE 192 >SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) Length = 1213 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 596 TNKVRGTRRSLRVPLASCIQTGRCPL 519 TN+ +G+RRS R P S +T R P+ Sbjct: 294 TNETKGSRRSTRNPNQSPAETARTPI 319 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +2 Query: 95 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 193 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 >SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) Length = 506 Score = 27.5 bits (58), Expect = 9.4 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Frame = +3 Query: 333 NSCC*QTKEATLXDIDLCV---QCYPRGL---GLPC*DRRQAHQGSSWTAHSSLRC 482 N+C TK T D+ C+ +CY G PC D Q+ Q WT +++LRC Sbjct: 389 NAC--YTKVGTQCDLRQCLISGRCYSYGTVNPSNPCQDC-QSRQKMGWTNNNALRC 441 >SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) Length = 151 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +1 Query: 202 VPMPKLKAFQKIQIRLVRELEKKFSG 279 VP+P++ A QK++ +L R++E+K +G Sbjct: 69 VPLPQVSAMQKVKGKL-RDMEQKLNG 93 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,284,901 Number of Sequences: 59808 Number of extensions: 362889 Number of successful extensions: 1029 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1028 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -