BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K21 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 26 1.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.1 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 25.8 bits (54), Expect = 1.2 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -1 Query: 455 WVSIFKLLRIAFIMAVSPKGVITTVMGIF*KPRIA 351 W+SI K + ++F++ +S ++TTV+G RI+ Sbjct: 322 WMSIQKGMIVSFMVPISFLIILTTVLGTLSLKRIS 356 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.0 bits (52), Expect = 2.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 405 GHSHYKCYPQKLKNGDPFYMFTYHSICCIKYCTKCSMY 518 G H++C KL GDP+ T + C+ C Y Sbjct: 699 GDDHHECRNLKLFEGDPYDNAT--TFTCVSNCPASHPY 734 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,561 Number of Sequences: 2352 Number of extensions: 12371 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -