BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K18 (492 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 75 9e-13 UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; ... 33 4.6 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 32 6.0 UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12... 32 8.0 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 74.9 bits (176), Expect = 9e-13 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = +1 Query: 202 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGNLVAGSIVSQLTAAAMVAPTP 375 IYGTGGLLTP+VAP+L YYGN+VAGS++SQLT+AAM+APTP Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVISQLTSAAMLAPTP 74 >UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; Aurantimonas sp. SI85-9A1|Rep: Putative uncharacterized protein - Aurantimonas sp. SI85-9A1 Length = 215 Score = 32.7 bits (71), Expect = 4.6 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Frame = +3 Query: 156 GASXCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNS-GRKHSRCCTSILRKFSGR-Q 329 G G GR+ + +G R+ + SGN G+ R C + GR Q Sbjct: 45 GEQSLAPGNSGRQITGKQKRSNNGQEAGQRSEPRHSGNERGKAEQRWCVDESNRRGGRSQ 104 Query: 330 HCVTVDCCCHGSPH 371 CV CHGSP+ Sbjct: 105 LCVAAAMRCHGSPN 118 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 32.3 bits (70), Expect = 6.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 138 QKLKEHGA--SXCISGKRGRRCCNIWHWGSVDSISGSRAR 251 Q L+EHG ++G+R RC N WH G D + R R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 >UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12; Bacilli|Rep: Pyrrolidone-carboxylate peptidase - Bacillus subtilis Length = 215 Score = 31.9 bits (69), Expect = 8.0 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 117 LRIARXEQKLKEHGASXCISGKRGRRCCNIWHWGSVDSIS 236 L + R K+KEHG +S G CN +G +D IS Sbjct: 117 LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHIS 156 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 444,653,911 Number of Sequences: 1657284 Number of extensions: 7843808 Number of successful extensions: 15782 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15778 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 28437262108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -