BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K18 (492 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual 26 3.5 SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces ... 25 6.2 SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosacchar... 25 6.2 >SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 25.8 bits (54), Expect = 3.5 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 207 WHW-GSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 314 W W GSVD SG N R S TS+LR+ Sbjct: 39 WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQ 75 >SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 25.0 bits (52), Expect = 6.2 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 232 MESTDPQCHILQHRRPRLPLMQXEAPCSF 146 M+S Q ++L RP LPL P F Sbjct: 88 MDSLSHQIYLLHKNRPTLPLKPTNQPTRF 116 >SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 25.0 bits (52), Expect = 6.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 390 TSPVLDIAPGSDLFCFIWN*NA 455 T P+ + P ++FC IW+ NA Sbjct: 411 THPLRSVIPLDNIFCNIWSDNA 432 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,826,877 Number of Sequences: 5004 Number of extensions: 32190 Number of successful extensions: 58 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 192109570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -