BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K16 (496 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_25385| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_35600| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_49174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) 34 0.074 SB_49063| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_33866| Best HMM Match : NOGCT (HMM E-Value=6.8) 32 0.30 SB_56625| Best HMM Match : DUF1443 (HMM E-Value=3.1) 29 2.1 SB_4269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_43502| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_51536| Best HMM Match : Trypsin (HMM E-Value=0) 27 6.4 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 27 6.4 SB_18818| Best HMM Match : Peptidase_C1 (HMM E-Value=1.1e-39) 27 8.5 SB_47669| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_2203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_49462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 659 Score = 37.5 bits (83), Expect = 0.006 Identities = 18/71 (25%), Positives = 37/71 (52%) Frame = +1 Query: 130 YDLNQAKELFEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKFAD 309 +D+ + F+ F ++H++ Y+DD++ F+ ++ I +N ++ N FAD Sbjct: 477 FDIPHLDDDFDEFRQQHDKVYEDDSEHRRRKHIFRHNVRYIRSMNRRSLPYKLEPNHFAD 536 Query: 310 YTPEEQQSRLG 342 T +E +S G Sbjct: 537 LTDDEFKSYKG 547 >SB_25385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/73 (23%), Positives = 37/73 (50%) Frame = +1 Query: 130 YDLNQAKELFEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKFAD 309 +++ + +F+ +VK+H + YKD+ + + FK +L I+ N ++ +N D Sbjct: 547 HNVEKVHRVFDKYVKKHKKNYKDNKEHHTRREHFKHNLRFIHSKNRRHAGYYLAMNHLGD 606 Query: 310 YTPEEQQSRLGLR 348 + +E + G R Sbjct: 607 RSDKELRVLRGRR 619 >SB_35600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 37.1 bits (82), Expect = 0.008 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Frame = +1 Query: 136 LNQAKEL----FEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKF 303 L Q++EL F+ F ++H++ Y+DD++ F+ ++ I +N ++ N F Sbjct: 132 LGQSRELVDDDFDEFRQQHDKVYEDDSEHRRRKHIFRHNVRYIRSMNRRSLPYKLEPNHF 191 Query: 304 ADYTPEEQQSRLG 342 AD T +E +S G Sbjct: 192 ADLTDDEFKSYKG 204 >SB_49174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 35.5 bits (78), Expect = 0.024 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +1 Query: 157 FEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKFADYTPEEQQSR 336 F+ F ++H++ Y+DD++ F+ ++ I +N ++ N FAD T +E +S Sbjct: 44 FDEFRQQHDKVYEDDSEHRRRKHIFRHNVRYIRSMNRRSLPYKLEPNHFADLTDDEFKSY 103 Query: 337 LG 342 G Sbjct: 104 KG 105 >SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1512 Score = 34.7 bits (76), Expect = 0.042 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = +1 Query: 157 FEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKFADYTPEEQQS 333 F+ F ++H++ Y+DD++ F+ ++ I +N ++ N FAD T +E +S Sbjct: 1194 FDEFRQQHDKVYEDDSEHRRRKHIFRHNVRYIRSMNRRSLPYKLEPNHFADLTDDEFKS 1252 >SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) Length = 1555 Score = 33.9 bits (74), Expect = 0.074 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +1 Query: 157 FEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKFADYTPEEQQSR 336 F+ F ++H++ Y+DD++ F+ ++ I +N ++ N FAD T +E +S Sbjct: 1286 FDEFRQQHDKMYEDDSEHCRRKHIFRHNVRYIRSMNRRSLPHKLEPNHFADLTDDEFKSY 1345 Query: 337 LG 342 G Sbjct: 1346 KG 1347 >SB_49063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 32.3 bits (70), Expect = 0.23 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Frame = +1 Query: 136 LNQAKEL----FEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKF 303 L Q+++L F+ F ++H++ +DD++ F+ ++ I +N ++ N F Sbjct: 53 LGQSRDLVDDDFDEFRQQHDKVCEDDSEHRRRKHIFRHNVRYIRSMNRRSLPYKLEPNHF 112 Query: 304 ADYTPEEQQSRLG 342 AD T +E +S G Sbjct: 113 ADLTDDEFKSYKG 125 >SB_33866| Best HMM Match : NOGCT (HMM E-Value=6.8) Length = 234 Score = 31.9 bits (69), Expect = 0.30 Identities = 16/71 (22%), Positives = 34/71 (47%) Frame = +1 Query: 130 YDLNQAKELFEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKFAD 309 Y + + F+ F ++H++ Y+DD++ F+ ++ I + ++ N F D Sbjct: 35 YSRDLVDDDFDEFRQQHDKVYEDDSEHRRRKHIFRHNVRYIRSMKRRSLPYKLEPNHFGD 94 Query: 310 YTPEEQQSRLG 342 T +E +S G Sbjct: 95 LTDDEFKSYKG 105 >SB_56625| Best HMM Match : DUF1443 (HMM E-Value=3.1) Length = 248 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 46 AKMNFVSVALLIATVVMASSAETDTPRHYDLNQA 147 A + F++ +L+ TV+ A+ ETD R NQA Sbjct: 98 AAVLFIAAMILVVTVLWATKQETDRNRQMSRNQA 131 >SB_4269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = +1 Query: 166 FVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTTFGINKFADYTPEEQQS 333 F ++H++ Y+DD+ F+ ++ I +N ++ N F D T +E +S Sbjct: 44 FREQHDKVYEDDSKHHRLKHIFRHNVRYIRSMNRRSLPYKLEPNHFGDLTDDEFKS 99 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +1 Query: 106 AETDTPRHYD---LNQAKELFEIFVK-EHNREYKDDADRELHYQSFKKHLAEINQLN 264 AE D R+ + Q E ++ FVK +H + K ADREL + +K + + N Sbjct: 250 AEEDKKRYVEELRAYQQSEQYQAFVKRQHVKRTKHPADRELEIRELRKSVLTSQEQN 306 >SB_43502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 27.5 bits (58), Expect = 6.4 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 16 SKPVPLLIHCAKMNFVSVALLIATVVMASSAETDTPRHYDL 138 S P+ LL+HC + L T +++SS DTP Y + Sbjct: 50 SMPMGLLLHCNHGSTEKAILNNITDIVSSSLPIDTPVKYQI 90 >SB_51536| Best HMM Match : Trypsin (HMM E-Value=0) Length = 347 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +2 Query: 368 KFCDFSLSECYSKRNKCIV--TACKMFK 445 K CDF + C+ K KC V CK+ K Sbjct: 45 KTCDFCVKPCFDKHTKCAVYKNFCKVPK 72 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 365 HKFCDFSLSECYSKRNKCIVTAC 433 H FC++ L KRN C + C Sbjct: 388 HSFCEYCLQSWLRKRNTCPICRC 410 >SB_18818| Best HMM Match : Peptidase_C1 (HMM E-Value=1.1e-39) Length = 504 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/57 (21%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 157 FEIFVKEHNREYKDDADRELHYQSFKKHLAEINQLNXKNPYTT-FGINKFADYTPEE 324 F F+K++ + Y+D+ + + F+ ++ + ++ + T +G F+D + EE Sbjct: 178 FNAFLKKYKKSYQDETEYRHRMKIFESNMRKAAKMQKMDSGTARYGPTIFSDLSEEE 234 >SB_47669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 112 TDTPRHYDLNQAKELFEIFVKEHNREYKDDADRELHYQSFKKHLAE 249 +D P+ +L+ + LFE + DD RE+ + +FK L E Sbjct: 520 SDEPKRSELDPQRTLFETGQGQGQVRRTDDEKREMFFIAFKDILPE 565 >SB_2203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 112 TDTPRHYDLNQAKELFEIFVKEHNREYKDDADRELHYQSFKKHLAE 249 +D P+ +L+ + LFE + DD RE+ + +FK L E Sbjct: 139 SDEPKRSELDPQRTLFETGQGQGQVRRTDDEKREMFFIAFKDILPE 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,801,445 Number of Sequences: 59808 Number of extensions: 248904 Number of successful extensions: 608 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -