BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K13 (363 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-16 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 6e-16 SB_56| Best HMM Match : Actin (HMM E-Value=0) 80 6e-16 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 80 6e-16 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 6e-16 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 8e-16 SB_54| Best HMM Match : Actin (HMM E-Value=0) 60 7e-10 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 59 9e-10 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 44 3e-05 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.21 SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) 31 0.21 SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) 31 0.28 SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.49 SB_46582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.65 SB_36161| Best HMM Match : SecIII_SopE_N (HMM E-Value=4.1) 29 0.85 SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) 29 1.5 SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_38782| Best HMM Match : PAN (HMM E-Value=2.3e-05) 27 3.4 SB_1849| Best HMM Match : His_leader (HMM E-Value=6.2) 27 3.4 SB_41533| Best HMM Match : SH2 (HMM E-Value=6.3e-25) 27 4.6 SB_59015| Best HMM Match : Arif-1 (HMM E-Value=0.62) 27 6.0 SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24) 27 6.0 SB_34833| Best HMM Match : E6 (HMM E-Value=7.2) 26 8.0 SB_20181| Best HMM Match : RhoGEF (HMM E-Value=0.038) 26 8.0 SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) 26 8.0 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 26 8.0 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 80.2 bits (189), Expect = 5e-16 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 129 KLPRLVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 245 ++ LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG Sbjct: 5 EIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 43 Score = 69.7 bits (163), Expect = 7e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 232 PAIRAVMVGMGQKDSYVXDEAQSKRGILTLKYPIEHG 342 P + VMVGMGQKDSYV DEAQSKRGILTLKYPIEHG Sbjct: 39 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG 75 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 79.8 bits (188), Expect = 6e-16 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 245 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG Sbjct: 8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 42 Score = 69.7 bits (163), Expect = 7e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 232 PAIRAVMVGMGQKDSYVXDEAQSKRGILTLKYPIEHG 342 P + VMVGMGQKDSYV DEAQSKRGILTLKYPIEHG Sbjct: 38 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG 74 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 79.8 bits (188), Expect = 6e-16 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 245 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG Sbjct: 8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 42 Score = 69.7 bits (163), Expect = 7e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 232 PAIRAVMVGMGQKDSYVXDEAQSKRGILTLKYPIEHG 342 P + VMVGMGQKDSYV DEAQSKRGILTLKYPIEHG Sbjct: 38 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG 74 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 79.8 bits (188), Expect = 6e-16 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 245 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG Sbjct: 9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 43 Score = 69.7 bits (163), Expect = 7e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 232 PAIRAVMVGMGQKDSYVXDEAQSKRGILTLKYPIEHG 342 P + VMVGMGQKDSYV DEAQSKRGILTLKYPIEHG Sbjct: 39 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG 75 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 79.8 bits (188), Expect = 6e-16 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 120 ATXKLPRLVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 245 A + LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG Sbjct: 2 ADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 43 Score = 69.7 bits (163), Expect = 7e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 232 PAIRAVMVGMGQKDSYVXDEAQSKRGILTLKYPIEHG 342 P + VMVGMGQKDSYV DEAQSKRGILTLKYPIEHG Sbjct: 39 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG 75 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 79.4 bits (187), Expect = 8e-16 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 245 LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG Sbjct: 8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 42 Score = 69.7 bits (163), Expect = 7e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 232 PAIRAVMVGMGQKDSYVXDEAQSKRGILTLKYPIEHG 342 P + VMVGMGQKDSYV DEAQSKRGILTLKYPIEHG Sbjct: 38 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG 74 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 59.7 bits (138), Expect = 7e-10 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 242 +V+DNGSG CKAG + D++PR VFP+IVGRPRH+ Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 59.3 bits (137), Expect = 9e-10 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 242 LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ Sbjct: 1359 LVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 44.4 bits (100), Expect = 3e-05 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 236 +V+DNG G+ K GFAGD PR + P++VG P+ Sbjct: 703 IVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQ 734 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 44.0 bits (99), Expect = 4e-05 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 233 +V DNG+G K G+AG + P +FPS+VGRP Sbjct: 9 IVCDNGTGFVKCGYAGSNFPAHIFPSMVGRP 39 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 268 KDSYVXDEAQSKRGILTLKYPIEHG 342 KD V DEA R +L + YP+++G Sbjct: 53 KDLMVGDEASQLRYMLEVNYPMDNG 77 >SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 41.9 bits (94), Expect = 1e-04 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = -2 Query: 239 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQA 138 MA + D GE+G+ SI+S ETGLAHTGAI+ Q+ Sbjct: 1 MARSADDGGENGSGSIVSGETGLAHTGAIIDNQS 34 >SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.21 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 214 GNTARGASSPAKPALHIPEPLSTT 143 GNT R PAKPAL++P P S T Sbjct: 80 GNTNRRTRIPAKPALNLPSPPSKT 103 >SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) Length = 170 Score = 31.5 bits (68), Expect = 0.21 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 214 GNTARGASSPAKPALHIPEPLSTT 143 GNT R PAKPAL++P P S T Sbjct: 80 GNTNRRTRIPAKPALNLPSPPSKT 103 >SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) Length = 2440 Score = 31.1 bits (67), Expect = 0.28 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +1 Query: 181 SQEMMLLAPCSPRSWEGPAIRAVMVGMGQKDSYVXDEAQ 297 S E + APCSPRS P I M G G + S+V +E + Sbjct: 803 SLESSIEAPCSPRSASKPVISGEMNG-GPRASHVIEETE 840 >SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 30.3 bits (65), Expect = 0.49 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 214 GNTARGASSPAKPALHIPEPLSTT 143 GNT R PAKP+L++P P S T Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563 >SB_46582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 0.65 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 189 LLRNRPCTYRSHCLLPSAATXSSHI 115 +LRNRP T+R LPS T +H+ Sbjct: 58 ILRNRPITFRLQVCLPSLQTAFNHL 82 >SB_36161| Best HMM Match : SecIII_SopE_N (HMM E-Value=4.1) Length = 535 Score = 29.5 bits (63), Expect = 0.85 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -1 Query: 243 PDGGAFPRSRGTRREEHHLLRNRPCTYRSHCLL--PSAATXSSHIVEL 106 P+G + P+ + +++ HH + T R HC+L P T SH++ + Sbjct: 110 PNGVSSPKKK--KKKHHHKHEEKHFTDRDHCILDNPKEKTHLSHLMHI 155 >SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) Length = 580 Score = 28.7 bits (61), Expect = 1.5 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +3 Query: 129 KLPRLVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGR 248 K+ LV+D G+ K GFA + APR++ P+ + + + + R Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI-PNAIFKAKSERR 270 >SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 2.0 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 214 GNTARGASSPAKPALHIPEPLSTT 143 GNT R AKPAL++P P S T Sbjct: 40 GNTNRRTRIQAKPALNLPSPPSKT 63 >SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 28.3 bits (60), Expect = 2.0 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 214 GNTARGASSPAKPALHIPEPLSTT 143 GNT R PAKP L IP P + T Sbjct: 68 GNTNRRTRIPAKPTLTIPSPPTKT 91 >SB_38782| Best HMM Match : PAN (HMM E-Value=2.3e-05) Length = 596 Score = 27.5 bits (58), Expect = 3.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 297 LCLISYIRVLLSHTDHHGPDGGAFPRSRGTRRE 199 LC++ R + +H PDGG GT+RE Sbjct: 539 LCMVLCARTSACVSFNHRPDGGICQLKNGTKRE 571 >SB_1849| Best HMM Match : His_leader (HMM E-Value=6.2) Length = 135 Score = 27.5 bits (58), Expect = 3.4 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -1 Query: 309 TSFALCLISYIRVLLSHTDHHGPDGGAFPRSRGTRREEHH 190 + F+L + + + ++DH PD A+ R T ++ HH Sbjct: 3 SGFSLSVQAVLTSETWYSDHQNPDSEAYQSLRATIQDNHH 42 >SB_41533| Best HMM Match : SH2 (HMM E-Value=6.3e-25) Length = 389 Score = 27.1 bits (57), Expect = 4.6 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 Query: 239 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQARQLXRR 120 ++ P DR HG +CE LA G I Y R+ R+ Sbjct: 46 LSAPPDDRWYHGKLDRKTCEERLAADGRIGAYLVRESDRK 85 >SB_59015| Best HMM Match : Arif-1 (HMM E-Value=0.62) Length = 526 Score = 26.6 bits (56), Expect = 6.0 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 273 VLLSHTDHHGPDGGAFPRSRGTRREEHHLLRNRPCTYRS 157 V L +T HH P G A R H L RN T RS Sbjct: 252 VRLYNTIHHRPTGNAAQTMICASRNSHTLSRNDHSTSRS 290 >SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24) Length = 766 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 141 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 239 +++D GS KAGFA ++A + + S++G H Sbjct: 485 IIIDLGSSSVKAGFAQEEA-QVFYISLIGILEH 516 >SB_34833| Best HMM Match : E6 (HMM E-Value=7.2) Length = 135 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 189 LLRNRPCTYRSHCLLP 142 L R R C YRSH LLP Sbjct: 52 LFRGRYCQYRSHNLLP 67 >SB_20181| Best HMM Match : RhoGEF (HMM E-Value=0.038) Length = 274 Score = 26.2 bits (55), Expect = 8.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 187 PAKPALHIPEPLSTTKRGNXFVAH 116 P P IP PLS TKR + V H Sbjct: 33 PVTPTTPIPLPLSATKRDSTRVYH 56 >SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) Length = 644 Score = 26.2 bits (55), Expect = 8.0 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 101 KTNSTMCDEXVAALGSRQWLRYVQGXXXXXXXXXXXVPLDRGKA 232 K++S +CD +A L R + Y +PLD+GK+ Sbjct: 398 KSSSDLCD-ALALLTRRLYTEYTDPMTIEPILASRLIPLDKGKS 440 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 26.2 bits (55), Expect = 8.0 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -1 Query: 327 VFEGQDTSFALCLISYIRVLLSHTDHHGPDGGAFPRSRG 211 V EG D FA C++SY+ LL + H G P++RG Sbjct: 238 VREGGDV-FANCVVSYVARLLRNRGHSRSLG--LPKTRG 273 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,814,062 Number of Sequences: 59808 Number of extensions: 243854 Number of successful extensions: 617 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -