BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K10 (572 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g04230.1 68416.m00447 40S ribosomal protein S16 (RPS16B) simi... 196 9e-51 At2g09990.1 68415.m01037 40S ribosomal protein S16 (RPS16A) Same... 195 2e-50 At5g18380.1 68418.m02162 40S ribosomal protein S16 (RPS16C) 194 3e-50 At3g49080.1 68416.m05362 ribosomal protein S9 family protein con... 45 4e-05 At1g43570.1 68414.m05001 hypothetical protein 32 0.24 At1g50650.1 68414.m05694 stigma-specific Stig1 family protein lo... 29 2.9 At3g24255.1 68416.m03045 expressed protein 28 3.8 At1g49430.1 68414.m05541 long-chain-fatty-acid--CoA ligase / lon... 27 8.9 >At3g04230.1 68416.m00447 40S ribosomal protein S16 (RPS16B) similar to 40S ribosomal protein S16 GB:AAD22696 [Arabidopsis thaliana] Length = 146 Score = 196 bits (478), Expect = 9e-51 Identities = 86/129 (66%), Positives = 111/129 (86%) Frame = +3 Query: 60 QAVQVFGRKKTATAVAYCKRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKEKFSMVD 239 ++VQ FGRKKTATAV YCKRG GM+++NG P++L +P +L++K+ EP+LLLGK +F+ VD Sbjct: 8 ESVQCFGRKKTATAVTYCKRGSGMIKLNGSPIELYQPEILRFKIFEPVLLLGKHRFAGVD 67 Query: 240 IRVTVKGGGHVXQVYAIRQAISKALIAFYQKYVXEASKKEIKDILXQYDRSLLVADPRRC 419 +R+ GGG+ +VYAIRQ+I+KAL+A+YQKYV E SKKEIKDIL +YDR+LLVADPRRC Sbjct: 68 MRIRATGGGNTSRVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILMRYDRTLLVADPRRC 127 Query: 420 EPKKFGGPG 446 E KKFGGPG Sbjct: 128 ESKKFGGPG 136 >At2g09990.1 68415.m01037 40S ribosomal protein S16 (RPS16A) Same as GB:Q42340 Length = 146 Score = 195 bits (475), Expect = 2e-50 Identities = 87/135 (64%), Positives = 113/135 (83%) Frame = +3 Query: 42 ARREPIQAVQVFGRKKTATAVAYCKRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKE 221 A + ++VQ FGRKKTA AV +CKRG G++++NG P++L +P +L++K+ EPILLLGK Sbjct: 2 ATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPILLLGKH 61 Query: 222 KFSMVDIRVTVKGGGHVXQVYAIRQAISKALIAFYQKYVXEASKKEIKDILXQYDRSLLV 401 +F+ V++R+ V GGGH QVYAIRQ+I+KAL+A+YQKYV E SKKEIKDIL +YDR+LLV Sbjct: 62 RFAGVNMRIRVNGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLV 121 Query: 402 ADPRRCEPKKFGGPG 446 ADPRRCEPKKFGG G Sbjct: 122 ADPRRCEPKKFGGRG 136 >At5g18380.1 68418.m02162 40S ribosomal protein S16 (RPS16C) Length = 146 Score = 194 bits (474), Expect = 3e-50 Identities = 86/135 (63%), Positives = 113/135 (83%) Frame = +3 Query: 42 ARREPIQAVQVFGRKKTATAVAYCKRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKE 221 A + ++VQ FGRKKTA AV +CKRG G++++NG P++L +P +L++K+ EP+LLLGK Sbjct: 2 ATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPVLLLGKH 61 Query: 222 KFSMVDIRVTVKGGGHVXQVYAIRQAISKALIAFYQKYVXEASKKEIKDILXQYDRSLLV 401 +F+ V++R+ V GGGH QVYAIRQ+I+KAL+A+YQKYV E SKKEIKDIL +YDR+LLV Sbjct: 62 RFAGVNMRIRVNGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLV 121 Query: 402 ADPRRCEPKKFGGPG 446 ADPRRCEPKKFGG G Sbjct: 122 ADPRRCEPKKFGGRG 136 >At3g49080.1 68416.m05362 ribosomal protein S9 family protein contains Pfam profile PF00380: ribosomal protein S9 Length = 430 Score = 44.8 bits (101), Expect = 4e-05 Identities = 28/79 (35%), Positives = 42/79 (53%) Frame = +3 Query: 78 GRKKTATAVAYCKRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKEKFSMVDIRVTVK 257 GR+K + A + + G G +VN + D+ P +L ++ L + DI+ TVK Sbjct: 310 GRRKCSIARVWIQPGEGKFQVNEKEFDVYFP-MLDHRAALLRPLAETKTLGRWDIKCTVK 368 Query: 258 GGGHVXQVYAIRQAISKAL 314 GGG QV AI+ IS+AL Sbjct: 369 GGGTTGQVGAIQLGISRAL 387 >At1g43570.1 68414.m05001 hypothetical protein Length = 348 Score = 32.3 bits (70), Expect = 0.24 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 418 QRRGSATSKLLSYCXRMSLISFFEASXTYFW*KAIR 311 +R S T + LSYC R+ LI S T FW A R Sbjct: 19 KRISSWTGRFLSYCGRLQLIKSVLMSITNFWSSAFR 54 >At1g50650.1 68414.m05694 stigma-specific Stig1 family protein low similarity to stigma-specific protein STIG1 [Nicotiana tabacum] GI:496647; contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 174 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = -3 Query: 138 HAAFHDHACNTQLRWRFSYVRILGRPGWAHVLPPAQQPF 22 H HD+ NT W S+++ W PP +P+ Sbjct: 22 HVLGHDNQLNTTSSWLKSHIKAATTTNWGRPKPPMCKPW 60 >At3g24255.1 68416.m03045 expressed protein Length = 836 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 415 RRGSATSKLLSYCXRMSLISFFEASXTYFW*KAIRAFEIACL 290 R G T++ LS+ R+ LIS S T FW A R AC+ Sbjct: 142 RIGKWTARHLSFAGRLQLISSVIHSLTNFWMSAFR-LPSACI 182 >At1g49430.1 68414.m05541 long-chain-fatty-acid--CoA ligase / long-chain acyl-CoA synthetase nearly identical to acyl CoA synthetase (MF45P) GI:1617268 from [Brassica napus] Length = 665 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +2 Query: 5 SVFLCQNGCCAGGKT*AHPGRPSIRT*ENRHRSCVLQAWSWN 130 S+ CQ GC + KT G S E CV +SWN Sbjct: 164 SILSCQKGCSSNLKTIVSFGEVSSTQKEEAKNQCV-SLFSWN 204 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,008,350 Number of Sequences: 28952 Number of extensions: 257026 Number of successful extensions: 695 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -