BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_K03 (433 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyce... 103 2e-23 SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosa... 27 1.6 SPBC646.08c |||oxysterol binding protein |Schizosaccharomyces po... 25 5.0 SPCC16C4.19 ||SPCC5E4.08|RNase MRP|Schizosaccharomyces pombe|chr... 25 6.6 >SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyces pombe|chr 3|||Manual Length = 122 Score = 103 bits (246), Expect = 2e-23 Identities = 55/120 (45%), Positives = 72/120 (60%) Frame = +3 Query: 54 VKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYHQ 233 +K ELR + +LRV K+ GG SKLSKI+ RK IAR+ V ++ Sbjct: 3 LKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRKDIARILTVINE 62 Query: 234 KMKVNLRNHYKNKKYKPLHLRAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVKA 413 ++ R YKNKKY PL LR KKTRA+R+ALT +E KT K+I+K+ FP R YA+KA Sbjct: 63 SNRLAAREAYKNKKYIPLDLRQKKTRAIRRALTPYEQSRKTLKQIKKERYFPLRKYALKA 122 >SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 26.6 bits (56), Expect = 1.6 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -3 Query: 425 IIYSSFNGIDSRW---EERFLSDLFPRLDLCF 339 +++ +F + + W E FLS +FPR CF Sbjct: 246 VVFGAFPSLHAGWAMLEALFLSHVFPRYRFCF 277 >SPBC646.08c |||oxysterol binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 516 Score = 25.0 bits (52), Expect = 5.0 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +3 Query: 270 KKYKPLHLRAKKTRAMRKALTKHEAKIKTRKEIRKKS 380 K Y+P R ++++ +TK K +K +K S Sbjct: 171 KSYRPKASRTTSSQSVASTMTKSSTKTSKKKSSKKNS 207 >SPCC16C4.19 ||SPCC5E4.08|RNase MRP|Schizosaccharomyces pombe|chr 3|||Manual Length = 184 Score = 24.6 bits (51), Expect = 6.6 Identities = 12/54 (22%), Positives = 23/54 (42%) Frame = +3 Query: 222 VYHQKMKVNLRNHYKNKKYKPLHLRAKKTRAMRKALTKHEAKIKTRKEIRKKSL 383 V+ + V LR H + + + + + + H AK+K R+ +R L Sbjct: 102 VHEIPLGVPLRLHQSKQALRAKAIAESSSTKLESRKSAHNAKVKQRQRLRASGL 155 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,461,991 Number of Sequences: 5004 Number of extensions: 23345 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 154067960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -