BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_J18 (447 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 26 0.14 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 7.0 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 26.2 bits (55), Expect = 0.14 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 303 FIIHRTVTTILTQNIGIHQCLNIFGVVMLNAF 208 FII V TILT ++ +H C N + + F Sbjct: 44 FIIAIYVLTILTSSVTLHVCFNSYMYAFTHIF 75 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 7.0 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = -3 Query: 118 EDFLSLQLTIPMCLENGVSG*RCIYSPRXIE 26 + F + +P +NG G IY+P ++ Sbjct: 280 QSFPLVSQRVPQLAKNGAYGPDMIYTPEDVK 310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,242 Number of Sequences: 336 Number of extensions: 1166 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10090848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -