BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_J08 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29837| Best HMM Match : MobC (HMM E-Value=6.8) 33 0.27 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_31639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_36986| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_915| Best HMM Match : GIY-YIG (HMM E-Value=0.67) 30 1.4 SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) 30 1.4 SB_5834| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_9582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_3417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 30 1.9 SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) 30 1.9 SB_45818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) 29 2.5 SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_35167| Best HMM Match : zf-HIT (HMM E-Value=0.046) 29 3.3 SB_47093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_49329| Best HMM Match : Neur_chan_LBD (HMM E-Value=0) 29 4.3 SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) 29 4.3 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 29 4.3 SB_28927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3) 29 4.3 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 29 4.3 SB_28413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_25522| Best HMM Match : Saccharop_dh_N (HMM E-Value=3.9) 28 5.7 SB_22380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_17583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59036| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) 28 5.7 SB_57839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37768| Best HMM Match : SpoVG (HMM E-Value=7.9) 28 5.7 SB_37548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) 28 7.6 SB_51880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_51100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_50941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) 28 7.6 SB_13523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_9586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_54| Best HMM Match : Actin (HMM E-Value=0) 28 7.6 SB_37753| Best HMM Match : zf-C2H2 (HMM E-Value=0.0023) 28 7.6 SB_21276| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_29837| Best HMM Match : MobC (HMM E-Value=6.8) Length = 327 Score = 32.7 bits (71), Expect = 0.27 Identities = 19/51 (37%), Positives = 31/51 (60%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ + T ++ ++ H+ S T T N + +NKRLSTLSSDRK+ Sbjct: 30 NRNTYQLFTKPNAPLQYVHRESNNPLTITKNIPAS--INKRLSTLSSDRKT 78 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 314 NQDSTRRHHHQASQTDSTTTGNDLSCYHLNKR 409 ++ ++H HQ + +T TGND + Y +NK+ Sbjct: 1031 DKQQIQQHQHQTTNAATTNTGNDSNSYVINKQ 1062 >SB_31639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/66 (25%), Positives = 29/66 (43%) Frame = +2 Query: 254 HHPYPQRQPQSHQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDR 433 H+ Q+QPQ Q Q +T A+ T +TTT N+ + H N + + Sbjct: 71 HNNKQQQQPQQQQQQQPQQQQATTTTATTTTATTTTTTTTSNNNNSNHNNSNHNNNKQQQ 130 Query: 434 KSPRQK 451 + +Q+ Sbjct: 131 QQQQQQ 136 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +2 Query: 269 QRQPQSHQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKR 409 Q+QPQ Q Q ++ Q T +TTT + H NK+ Sbjct: 29 QQQPQQQQQQQQQQQQPQQQQQQQPQQQATTTTTTTTSNNSNHNNKQ 75 >SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +2 Query: 254 HHPYPQRQPQSHQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYH 397 +HP P +H N+ H P NQ ST H ++ T N L+ H Sbjct: 628 NHPSNVHTPDNHLNTVHTPDNQPST-VHTPDNQPSNVHTPDNHLNTVH 674 >SB_36986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S ST T N + +NKRLSTLSSD+++ Sbjct: 319 NRNTYQPFTKPNAPLQYVHRESNHPSTITKNIPAS--INKRLSTLSSDKET 367 >SB_915| Best HMM Match : GIY-YIG (HMM E-Value=0.67) Length = 336 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/51 (35%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N T ++ ++ H+ S T T N +S +NKRLSTLSSD+++ Sbjct: 28 NRNPYQPSTKPNAPLQYVHRESNLQPTITKN-ISA-SINKRLSTLSSDKET 76 >SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) Length = 776 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +3 Query: 303 TSPQTRILRAVITTKRHRPIQPLLATIYPATT*TSDSVHCHQTARA 440 T+PQ R+VIT +RHRPI+ ++ P T +S + C + +A Sbjct: 703 TTPQVANKRSVITRRRHRPIEG--SSSEPDTPASSCTSSCSKAIKA 746 >SB_5834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +2 Query: 299 QHVPTNQDSTR--RHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 QH+P + R ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 185 QHLPAFHQTERPIQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 231 >SB_9582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N +NKRLSTLSSD+K+ Sbjct: 142 NRNTYQPFTKPNAPLQYVHRESNNPLTITKNIPGS--INKRLSTLSSDKKT 190 >SB_3417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 249 NSIIHIHNDNHKATRTHNTSPQTRILRAVITTKRH 353 N + IHN N TRTHN + TR ++ T+ H Sbjct: 99 NMVTRIHNHN-MVTRTHNHNMVTRAHNHIMVTRAH 132 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 234 RSGRCNSIIHIHNDNHKATRTHNTSPQTRILRAVITTKRHRPI 362 R+ N + HN N TR HN + TRI ++ T+ H I Sbjct: 220 RTHNHNMVTRTHNHN-MVTRAHNHNMVTRIHNHIMVTRIHNHI 261 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 234 RSGRCNSIIHIHNDNHKATRTHNTSPQTRILRAVITTKRH 353 R+ N + IHN N TRTHN + TR + T+ H Sbjct: 202 RAHNHNMVTRIHNHN-MVTRTHNHNMVTRTHNHNMVTRAH 240 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +2 Query: 338 HHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKSPRQKPHCFPSIKNRSSLWLNQ 502 ++++S+ DS + G+ + ++ S SS R SPR P PSI R + + Q Sbjct: 241 YNRSSKYDSQSGGSQRTTPAVSPYQSPSSSARSSPRGSPTASPSISRRRAKFQQQ 295 >SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) Length = 594 Score = 29.9 bits (64), Expect = 1.9 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 9/96 (9%) Frame = +3 Query: 108 TNIPDN*-RSNFGARSQTASSAF-RLLPPGGHADH--SSP--HGPDG-LRSGRCNSIIHI 266 T+ PD+ + + ++S+ +S F PPG H H S P H P + G CN Sbjct: 77 TSAPDHGTQESKSSKSKHSSGHFCSTCPPGPHTHHVYSPPNCHPPATFVEHGHCNCQPTA 136 Query: 267 HNDNHKATRTHNTSPQTRILRAVI--TTKRHRPIQP 368 + DNH H+ S Q R + V RP+QP Sbjct: 137 YLDNHYHYAHHSQSAQPRPVAVVAHPPPLLLRPLQP 172 >SB_45818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.5 bits (63), Expect = 2.5 Identities = 27/86 (31%), Positives = 35/86 (40%), Gaps = 3/86 (3%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKSPRQKPHCF- 463 H + P S RR Q +++ TTG C L TLSS +S +K C Sbjct: 63 HSRRKKRPEKTRSFRRTTGQKTRSFRRTTGQKTRCSRRRSDLKTLSSRLRS-GEKTRCSR 121 Query: 464 --PSIKNRSSLWLNQDLNTKIFCRHT 535 +K RSS L D T+ R T Sbjct: 122 RRSDLKTRSSR-LRSDEKTRCSRRRT 146 >SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 919 Score = 29.5 bits (63), Expect = 2.5 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 3/75 (4%) Frame = +2 Query: 275 QPQSHQNSQHVPTNQDSTRRHH-HQASQTDSTT--TGNDLSCYHLNKRLSTLSSDRKSPR 445 Q HQ QH + RHH H++S STT +G S + R + L S R Sbjct: 426 QTSKHQQDQHHHHHHHHHHRHHKHRSSSGHSTTEASGRRASDHSHEMRATPLDS-RHGIA 484 Query: 446 QKPHCFPSIKNRSSL 490 P +P +N L Sbjct: 485 AVPMKYPQTRNHRPL 499 >SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +2 Query: 356 TDSTTTGNDLSCYHLNKRLSTLSSDR--KSPRQKPHCFPSIKNRSSLWLNQDLNTKIFCR 529 + T GN L LN +L LSS+R KS KPHC + S ++TK Sbjct: 45 SSGTCNGNSLRV--LNAQLGILSSERVTKSTSAKPHCDTDVPAVPSGLAGLSMDTKGLSF 102 Query: 530 HTKSKSRAG 556 ++ S AG Sbjct: 103 NSIQHSDAG 111 >SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1925 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 2/70 (2%) Frame = +2 Query: 254 HHPYPQRQPQSHQ--NSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSS 427 HH Q P + +Q +PT T+ H+Q QT + + +H + L+T + Sbjct: 1451 HHHQTQSLPTTPNITKNQSLPTTPTITKHSHYQQHQTSPNPVITNNTHHHQTQSLTTTPN 1510 Query: 428 DRKSPRQKPH 457 K + H Sbjct: 1511 ITKPSHYQQH 1520 >SB_35167| Best HMM Match : zf-HIT (HMM E-Value=0.046) Length = 632 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +3 Query: 150 SQTASSAFRLLPPGGHADHSSPHGPDGLRSGRCNSIIHIHNDNHKATRTHNTS 308 S++ + A PGG + PH + +R GRC + ++ N A TH + Sbjct: 284 SKSRTHAMVACYPGGGTGYK-PHVDNPIRDGRCITTLYYVNPEWNARNTHTVN 335 >SB_47093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 135 NRNTYQPFTKSNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 183 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKSPRQ 448 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Q Sbjct: 1265 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKETFNQ 1316 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 251 LHHPYPQRQPQSHQNSQHVPTNQDSTRRHHHQASQTDSTTTGN 379 L H P + + +S+ PT DS+RR + AS STT G+ Sbjct: 1001 LDHTKPPLRKTTSNDSK--PTEPDSSRRTYRAASMDASTTAGS 1041 >SB_49329| Best HMM Match : Neur_chan_LBD (HMM E-Value=0) Length = 716 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = +3 Query: 147 RSQTASSAFRLLPPGGHADHSSPHGPDGLRSGRCNSIIHIHNDNHKATRTHNTSPQTRIL 326 RS + S+ L PP +AD+ + H L S + + D ++ HN SP + Sbjct: 494 RSVSRRSSEVLSPPDMYADNLNSHRDRNLYSDQFRGRQEVFFDQYRTNCYHNDSPPDPLN 553 Query: 327 RA 332 RA Sbjct: 554 RA 555 >SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) Length = 918 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 163 NRNTYQPFTKPNAPLQYVHRESNHQPTITKNIPAS--INKRLSTLSSDKET 211 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = +2 Query: 395 HLNKRLSTLSSDRKS 439 H+NKRLSTLSSD+++ Sbjct: 1387 HINKRLSTLSSDKET 1401 >SB_28927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 83 NRNTYQPFTKPNAPLQYVHRESNHQPTITKNIPAS--INKRLSTLSSDKET 131 >SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3) Length = 466 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKSPRQ 448 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Q Sbjct: 371 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKETFNQ 422 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 924 NRNTYQPFTKPNAPLQYVHRESNHPPTVTKNIPAS--INKRLSTLSSDKET 972 >SB_28413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 83 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 131 >SB_25522| Best HMM Match : Saccharop_dh_N (HMM E-Value=3.9) Length = 285 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 135 NRNTYQPFTKPNAPLQYVHRESSHPPTITKNIPAS--INKRLSTLSSDKET 183 >SB_22380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/61 (27%), Positives = 26/61 (42%) Frame = +3 Query: 261 HIHNDNHKATRTHNTSPQTRILRAVITTKRHRPIQPLLATIYPATT*TSDSVHCHQTARA 440 H+ H + H T+ + + +TT+RH IQ + T TT + H T R Sbjct: 383 HVTTQCHVTIQRHVTTQRQVTTQRQVTTQRHVTIQRHVTTQRHVTTQRQVTTQRHVTTRR 442 Query: 441 Q 443 Q Sbjct: 443 Q 443 >SB_17583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 37 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 85 >SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 756 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 159 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 207 >SB_59036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 30 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 78 >SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) Length = 243 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 154 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 202 >SB_57839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 30 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 78 >SB_37768| Best HMM Match : SpoVG (HMM E-Value=7.9) Length = 163 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 83 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 131 >SB_37548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 83 NRNTYQPFTKPNAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 131 >SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) Length = 595 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/45 (28%), Positives = 27/45 (60%) Frame = +2 Query: 341 HQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKSPRQKPHCFPSIK 475 HQ Q ++T G ++SC ++ +++ +SDRK ++ + P+ K Sbjct: 515 HQKFQREATRLGRNISC-NIGMSVNSQNSDRKGSTRQSNKTPTWK 558 >SB_51880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD ++ Sbjct: 32 NRNTYQPFTKPNAPLQYVHRESNHQPTITKNIPAS--INKRLSTLSSDEET 80 >SB_51100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N + +NKRLSTLSSD ++ Sbjct: 37 NRNTYQPFTKPNAPLQYVHRESNHQPTITKNIPAS--INKRLSTLSSDEET 85 >SB_50941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 183 PPGGHADHSSPHGP 224 PP GHADHS+ GP Sbjct: 82 PPKGHADHSAKGGP 95 >SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) Length = 1826 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/51 (33%), Positives = 31/51 (60%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S T T N +S +NKRLSTLSS++++ Sbjct: 707 NRNTYQPFTKPNAPLQYVHRESNNPPTITKN-ISA-SINKRLSTLSSNKET 755 >SB_13523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T ++ ++ H+ S +T T N + +NKRLSTLS+D+++ Sbjct: 50 NRNTYQSFTKPNAPLQYVHRESNHPTTITKNIPAS--INKRLSTLSADKET 98 >SB_9586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 287 HQNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 ++N+ T + ++ H+ S T T N + +NKRLSTLSSD+++ Sbjct: 987 NRNTYQPFTKPSAPLQYVHRESNHPPTITKNIPAS--INKRLSTLSSDKET 1035 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 27.9 bits (59), Expect = 7.6 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = +2 Query: 254 HHPYPQRQPQSH-QNSQHVPTNQDSTRRHHHQASQTDSTTTGNDLS---CYHLNK-RLST 418 H P+P S H+PT R+ Q S S ND + H N+ +++ Sbjct: 886 HPPHPGNSMGSACYPDYHLPTPPQKQRQTSGQTSVKVSLNILNDETNRPTEHPNQAKMNN 945 Query: 419 LSSDRKSPRQKPH 457 ++D+KSP +PH Sbjct: 946 PATDKKSPNPRPH 958 >SB_37753| Best HMM Match : zf-C2H2 (HMM E-Value=0.0023) Length = 650 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +2 Query: 260 PYPQRQPQSHQNSQHVPTNQDSTRRHHHQASQTDSTTTGND 382 P +QP S + QH T+ H QAS + + D Sbjct: 409 PSTSQQPSSSTSKQHASTSHQRASTSHQQASSSQQQASSVD 449 >SB_21276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 341 HQASQTDSTTTGNDLSCYHLNKRLSTLSSDRKS 439 H+ S T T N + +NKRLSTLSSD+K+ Sbjct: 78 HRESNHPPTITKNIPAS--INKRLSTLSSDKKT 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,316,394 Number of Sequences: 59808 Number of extensions: 456044 Number of successful extensions: 1763 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 1455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1741 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -