BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_J01 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 25 0.84 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 6.0 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 24.6 bits (51), Expect = 0.84 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 364 QIFYGLFTNSNVVILAQVKLGFYCLFG*SRKTVKKL 257 QI G+ + + V + +K+ YCLFG S T ++ Sbjct: 516 QIRVGVHSGAVVAGIVGLKMPRYCLFGDSVNTASRM 551 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +3 Query: 216 DLTKRNVWHLNSLRSFLTVFLLYPN 290 +LTK + W L+ +++ + +L+ N Sbjct: 272 ELTKIDKWFLHKMKNIIDYYLVLEN 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,451 Number of Sequences: 438 Number of extensions: 3296 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -