BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I23 (353 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U57846-1|AAB02265.1| 51|Homo sapiens ribosomal protein L39 pro... 56 3e-08 D79205-1|BAA11465.1| 51|Homo sapiens ribosomal protein L39 pro... 56 3e-08 BC070205-1|AAH70205.1| 51|Homo sapiens ribosomal protein L39 p... 56 3e-08 BC001019-1|AAH01019.1| 51|Homo sapiens ribosomal protein L39 p... 56 3e-08 AB061835-1|BAB79473.1| 51|Homo sapiens ribosomal protein L39 p... 56 3e-08 AB209077-1|BAD92314.1| 70|Homo sapiens ribosomal protein L39 v... 55 7e-08 L05096-1|AAC15859.1| 51|Homo sapiens ribosomal protein L39 pro... 50 2e-06 BC012328-1|AAH12328.1| 51|Homo sapiens ribosomal protein L39-l... 50 2e-06 AF548529-1|AAN52397.1| 51|Homo sapiens ribosomal protein L39-2... 50 2e-06 AB063610-1|BAC19837.1| 51|Homo sapiens ribosomal protein L39-l... 50 2e-06 >U57846-1|AAB02265.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 56.0 bits (129), Expect = 3e-08 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >D79205-1|BAA11465.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 56.0 bits (129), Expect = 3e-08 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >BC070205-1|AAH70205.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 56.0 bits (129), Expect = 3e-08 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >BC001019-1|AAH01019.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 56.0 bits (129), Expect = 3e-08 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >AB061835-1|BAB79473.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 56.0 bits (129), Expect = 3e-08 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >AB209077-1|BAD92314.1| 70|Homo sapiens ribosomal protein L39 variant protein. Length = 70 Score = 54.8 bits (126), Expect = 7e-08 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W+RM+TGN IRYN+KRRHW+RTKL L Sbjct: 41 PIPQWIRMKTGNKIRYNSKRRHWKRTKLGL 70 >L05096-1|AAC15859.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 >BC012328-1|AAH12328.1| 51|Homo sapiens ribosomal protein L39-like protein. Length = 51 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 >AF548529-1|AAN52397.1| 51|Homo sapiens ribosomal protein L39-2 protein. Length = 51 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 >AB063610-1|BAC19837.1| 51|Homo sapiens ribosomal protein L39-like protein. Length = 51 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = +2 Query: 101 PFLSWVRMRTGNTIRYNAKRRHWRRTKLKL 190 P W++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 22 PIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,261,576 Number of Sequences: 237096 Number of extensions: 516517 Number of successful extensions: 1228 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2075554296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -