BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I23 (353 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 1.4 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 20 7.5 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 1.4 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = -2 Query: 202 FTSLQLELCPSPVTPLSVISNSVSCAHPYPAEEWVCFVSAFWPICAL 62 F + + S V+ + +++ A + EWV V +W C L Sbjct: 298 FNCIMFMVASSVVSTILILNYHHRNADTHEMSEWVKVVFLYWLPCIL 344 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +2 Query: 143 RYNAKRRHWRRTK 181 RY+ +R+WR+ K Sbjct: 26 RYSKLKRNWRKPK 38 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,490 Number of Sequences: 438 Number of extensions: 1030 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8184330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -