BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I20 (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) 28 5.1 >SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/69 (31%), Positives = 28/69 (40%) Frame = +3 Query: 390 EFVDIEAKFYSEVHAXXXXXXXXXXXXXXXRALIVNGTYEPNDDECLNPWRDDTEQQELA 569 E +E KFY EVHA R I +G EP D+EC W D E ++ A Sbjct: 141 ECCKLEGKFYEEVHALECKYAEKFKPFYEKRRNIASGGVEPTDEEC--RWPSDAEDEDEA 198 Query: 570 RAVQNAAIT 596 + T Sbjct: 199 EEKEEKEAT 207 >SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) Length = 365 Score = 28.3 bits (60), Expect = 5.1 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 501 TYEPNDDECLNPWRDDTEQQEL 566 TYE D+ C +PW+D +++ E+ Sbjct: 268 TYERLDNSCTSPWQDVSQKSEV 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,638,225 Number of Sequences: 59808 Number of extensions: 346579 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -