BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I15 (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 6.0 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 6.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.0 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 6.0 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 6.0 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.9 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 150 LFRRPK*ILLNSSKSRPVKL 91 LFR PK I +N+++ + +KL Sbjct: 119 LFRGPKGIQINATELQKIKL 138 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/50 (22%), Positives = 27/50 (54%) Frame = +1 Query: 400 PRVVEHALRVLHKGEAAVVRVCRIS*RRADHDLPSGTRHQVRNGDRVLDI 549 P+ +++ +R KG+ + + S ++ H LP+G R + + + L++ Sbjct: 37 PKGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPTGFRKVLVHNVKELEV 86 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -1 Query: 316 DWTIGGHRDGML 281 +W +G H DG L Sbjct: 518 EWKVGNHEDGYL 529 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -1 Query: 316 DWTIGGHRDGML 281 +W +G H DG L Sbjct: 433 EWKVGNHEDGYL 444 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -1 Query: 316 DWTIGGHRDGML 281 +W +G H DG L Sbjct: 752 EWKVGNHEDGYL 763 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 539 SSILXXDEKHSDILWNTAVVISD 607 S + DE SD+L+N VV D Sbjct: 562 SVFVVPDEVPSDVLYNRLVVSED 584 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 539 SSILXXDEKHSDILWNTAVVISD 607 S + DE SD+L+N VV D Sbjct: 562 SVFVVPDEVPSDVLYNRLVVSED 584 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -2 Query: 504 RRKVVVGPSSADSANSHHGCFSLVQNAKG 418 RR ++ S H CF V+N KG Sbjct: 542 RRNAATWKNAVRHNLSLHKCFMRVENVKG 570 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,788 Number of Sequences: 438 Number of extensions: 3597 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -