Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P02_F_I13
         (325 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   1.6  
M12598-1|AAA27733.1|   77|Apis mellifera protein ( Bee preprosec...    20   8.6  
AY082691-1|AAL92482.1|   77|Apis mellifera preprosecapin protein.      20   8.6  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 1.6
 Identities = 11/45 (24%), Positives = 24/45 (53%)
 Frame = -1

Query: 298 VMSSCYWLXPQXXVKLKMIVFNKGIWNGLNGVILEGGHILPISIF 164
           V   CY+       + ++ VF  G+   ++G+++  G ++ IS+F
Sbjct: 160 VAEVCYFTAHVTHPRHRLCVFVAGVVFIVSGLLMLVGMVMYISVF 204


>M12598-1|AAA27733.1|   77|Apis mellifera protein ( Bee
           preprosecapin mRNA, complete cds. ).
          Length = 77

 Score = 19.8 bits (39), Expect = 8.6
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 272 PPGXRKVKNDC 240
           PPG + +KN C
Sbjct: 62  PPGSKFIKNRC 72


>AY082691-1|AAL92482.1|   77|Apis mellifera preprosecapin protein.
          Length = 77

 Score = 19.8 bits (39), Expect = 8.6
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 272 PPGXRKVKNDC 240
           PPG + +KN C
Sbjct: 62  PPGSKFIKNRC 72


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,326
Number of Sequences: 438
Number of extensions: 1179
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7093251
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)