BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I12 (627 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 71 5e-13 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 71 8e-13 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 68 6e-12 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 68 6e-12 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 66 1e-11 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 64 7e-11 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 64 1e-10 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 64 1e-10 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 62 2e-10 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 62 4e-10 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 61 5e-10 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 61 7e-10 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 61 7e-10 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 58 5e-09 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 58 5e-09 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 54 6e-08 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 53 1e-07 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 51 5e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 1e-06 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 48 4e-06 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 48 7e-06 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 47 1e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 46 3e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 46 3e-05 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 45 5e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 5e-05 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 44 1e-04 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 44 1e-04 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 43 1e-04 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 42 3e-04 At5g61340.1 68418.m07697 expressed protein 42 4e-04 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 42 4e-04 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 41 8e-04 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 41 8e-04 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 40 0.001 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 40 0.001 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 40 0.002 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 39 0.003 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 38 0.005 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 38 0.007 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 38 0.007 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 38 0.007 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 38 0.007 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 37 0.010 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 37 0.013 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 37 0.013 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 36 0.022 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 36 0.029 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 36 0.029 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 34 0.067 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 33 0.12 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 33 0.12 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 32 0.27 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 32 0.27 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 32 0.27 At3g03860.1 68416.m00398 expressed protein 32 0.36 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 32 0.36 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 2.5 At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, pu... 28 4.4 At4g30280.1 68417.m04304 xyloglucan:xyloglucosyl transferase, pu... 28 4.4 At1g65310.1 68414.m07406 xyloglucan:xyloglucosyl transferase, pu... 28 4.4 At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein /... 28 4.4 At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein /... 28 4.4 At4g31240.2 68417.m04435 expressed protein 28 5.8 At4g31240.1 68417.m04434 expressed protein 28 5.8 At4g02330.1 68417.m00317 pectinesterase family protein contains ... 27 7.7 At1g78740.1 68414.m09177 hypothetical protein 27 7.7 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 27 7.7 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 71.3 bits (167), Expect = 5e-13 Identities = 32/91 (35%), Positives = 50/91 (54%) Frame = +3 Query: 60 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 239 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDEL 71 Query: 240 XXXASEYNINSMPTFVFVKNGKKLDEFSGAN 332 A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 72 QSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 70.5 bits (165), Expect = 8e-13 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 2/111 (1%) Frame = +3 Query: 12 PALEIRAFV*KPKMSIHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEI 185 P EI F + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+ Sbjct: 25 PRPEIYPFKVNSPCIVEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEEL 84 Query: 186 AAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 338 AA+ E+N++++P VF+K G+++D G VD Sbjct: 85 AAKYTDVEFVKIDVDVLMSVW-MEFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 67.7 bits (158), Expect = 6e-12 Identities = 31/94 (32%), Positives = 53/94 (56%) Frame = +3 Query: 51 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 230 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDID 332 Query: 231 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 332 AS +NI+S+PTF F+++GK++D+ GA+ Sbjct: 333 KANDVAAS-WNISSVPTFCFIRDGKEVDKVVGAD 365 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 67.7 bits (158), Expect = 6e-12 Identities = 29/79 (36%), Positives = 45/79 (56%) Frame = +3 Query: 93 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINS 272 L + DK V++DF ATWCGPC+++ P L+E++ + A++Y I + Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEA 130 Query: 273 MPTFVFVKNGKKLDEFSGA 329 +PTF+ K+GK D F GA Sbjct: 131 LPTFILFKDGKLWDRFEGA 149 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 66.5 bits (155), Expect = 1e-11 Identities = 30/77 (38%), Positives = 44/77 (57%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 287 +KL+V+DF A+WCGPC+MI P + + A+ A E+N+ +MPTFV Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAM-ADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFV 105 Query: 288 FVKNGKKLDEFSGANVD 338 VK GK+++ GA D Sbjct: 106 LVKRGKEIERIIGAKKD 122 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 64.1 bits (149), Expect = 7e-11 Identities = 33/92 (35%), Positives = 50/92 (54%) Frame = +3 Query: 57 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 236 I K+S D K A+ K+VV +F ATWCGPCK++ P E+ +E Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDE 86 Query: 237 XXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 332 +S ++I + PTF F+KNG+++ + GAN Sbjct: 87 LSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 63.7 bits (148), Expect = 1e-10 Identities = 32/96 (33%), Positives = 52/96 (54%) Frame = +3 Query: 51 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 230 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDT 67 Query: 231 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 338 AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 68 DELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 287 DK V++D+ ATWCGPC+ + P L+E++ + A++Y I ++PTF+ Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFI 140 Query: 288 FVKNGKKLDEFSGA 329 K+G+ D F GA Sbjct: 141 LFKDGEPCDRFEGA 154 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 62.5 bits (145), Expect = 2e-10 Identities = 30/90 (33%), Positives = 43/90 (47%) Frame = +3 Query: 69 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 248 D D + AGDK+VV+D WCGPCK+I PK E++ + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPL 143 Query: 249 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 338 A E I +PTF +K+ K + E +GA + Sbjct: 144 AKELGIRVVPTFKILKDNKVVKEVTGAKYE 173 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 61.7 bits (143), Expect = 4e-10 Identities = 30/80 (37%), Positives = 43/80 (53%) Frame = +3 Query: 99 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 278 + +KL+VIDF A WCGPCK + P++ EIA++ A Y ++P Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASK-YSEAVFARVDVDRLMDVAGTYRAITLP 98 Query: 279 TFVFVKNGKKLDEFSGANVD 338 FVFVK G+++D GA D Sbjct: 99 AFVFVKRGEEIDRVVGAKPD 118 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 61.3 bits (142), Expect = 5e-10 Identities = 31/85 (36%), Positives = 42/85 (49%) Frame = +3 Query: 84 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 263 K + A KL+VIDF A+WC PC+ I P E+A + A E+ Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKF-TNVVFFKIDVDELQAVAQEFK 77 Query: 264 INSMPTFVFVKNGKKLDEFSGANVD 338 + +MPTFVF+K G +D GA D Sbjct: 78 VEAMPTFVFMKEGNIIDRVVGAAKD 102 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 60.9 bits (141), Expect = 7e-10 Identities = 30/90 (33%), Positives = 49/90 (54%) Frame = +3 Query: 60 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 239 ++ DS+ +T++ E+ D V+++F A WCGPC+MI P +D++A + Sbjct: 90 NLSDSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147 Query: 240 XXXASEYNINSMPTFVFVKNGKKLDEFSGA 329 A+ Y I S+PT + K G+K D GA Sbjct: 148 PNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 60.9 bits (141), Expect = 7e-10 Identities = 30/90 (33%), Positives = 42/90 (46%) Frame = +3 Query: 69 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 248 D D + AG+KLVV+D WCGPCK+I PK ++ + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPL 133 Query: 249 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 338 A E I +PTF +K+ K + E +GA D Sbjct: 134 AKELGIRVVPTFKILKDNKVVKEVTGAKYD 163 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 58.0 bits (134), Expect = 5e-09 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +3 Query: 84 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 263 K + A KL+VIDF ATWC PC+ I P ++ A+ A E+ Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADL-AKKHLDVVFFKVDVDELNTVAEEFK 77 Query: 264 INSMPTFVFVKNGKKLDEFSGA 329 + +MPTF+F+K G+ + GA Sbjct: 78 VQAMPTFIFMKEGEIKETVVGA 99 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 58.0 bits (134), Expect = 5e-09 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = +3 Query: 72 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA 251 +D L D+ V +DF A WCGPCKMI P ++E+A + Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATP 139 Query: 252 SEYNINSMPTFVFVKNGKKLDEFSGA 329 +Y + S+PT + NG+K D GA Sbjct: 140 GQYGVRSIPTIMIFVNGEKKDTIIGA 165 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 54.4 bits (125), Expect = 6e-08 Identities = 24/71 (33%), Positives = 34/71 (47%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 296 VV+DF A WCGPCKMI P ++++A +Y + S+PT + Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160 Query: 297 NGKKLDEFSGA 329 G+K D GA Sbjct: 161 GGEKKDTIIGA 171 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 53.2 bits (122), Expect = 1e-07 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 296 V+++F +WCGPC+M+ +DEIA + A EY I ++P + K Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 297 NGKKLDEFSG 326 NG+K + G Sbjct: 147 NGEKRESIMG 156 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 51.2 bits (117), Expect = 5e-07 Identities = 19/65 (29%), Positives = 36/65 (55%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 296 V+++F+ATWCGPCK+I P ++ ++ E +E+ + +P F+ K Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 297 NGKKL 311 +GK++ Sbjct: 150 DGKEV 154 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +3 Query: 45 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 194 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 48.4 bits (110), Expect = 4e-06 Identities = 32/98 (32%), Positives = 43/98 (43%), Gaps = 1/98 (1%) Frame = +3 Query: 42 KPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXX 221 KP M + DL L AGDKLVV+DF + CG CK + PK+ +I AE Sbjct: 92 KPNMK-SVTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKI-AEKNPEVEFLQ 149 Query: 222 XXXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFSGAN 332 NI+ +P F F + ++ FS N Sbjct: 150 VNYEEHRSLCQSLNIHVLPFFRFYRGSSGRVCSFSCTN 187 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 47.6 bits (108), Expect = 7e-06 Identities = 23/79 (29%), Positives = 43/79 (54%) Frame = +3 Query: 96 AEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 275 A + K++V++F A+WC P K I P E+A+ + E+N+++ Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELAS-TYTSMIFVTIDVEELAEFSHEWNVDAT 116 Query: 276 PTFVFVKNGKKLDEFSGAN 332 PT VF+K+G+++D+ G + Sbjct: 117 PTVVFLKDGRQMDKLVGGD 135 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 46.8 bits (106), Expect = 1e-05 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 3/94 (3%) Frame = +3 Query: 63 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 236 +K ++ +++A D + V F A WCGPC+ I P + E++ + Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDEG 148 Query: 237 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 335 S+ NI ++PT F K G K E GA+V Sbjct: 149 GISNTISKLNITAVPTLHFFKGGSKKGEVVGADV 182 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 45.6 bits (103), Expect = 3e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +3 Query: 45 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 224 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 225 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 323 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 45.6 bits (103), Expect = 3e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +3 Query: 45 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 224 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 225 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 323 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 44.8 bits (101), Expect = 5e-05 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +3 Query: 63 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 236 +K + + L++A D + V F A WCGPC++I P + E++ + Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDEG 113 Query: 237 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 335 A + N++++PT F K G K E G +V Sbjct: 114 GLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDV 147 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 44.8 bits (101), Expect = 5e-05 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 1/91 (1%) Frame = +3 Query: 63 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 242 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDVQFLQVNYEEHK 160 Query: 243 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 332 ++ +P F F + + ++ FS N Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTN 191 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.6 bits (98), Expect = 1e-04 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +3 Query: 57 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 236 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++ AE Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQL-AETNPNVMFLKVNQEE 146 Query: 237 XXXXASEYNINSMPTFVFVKNGK-KLDEFS 323 N++ +P F F + + K+ FS Sbjct: 147 LRTMCHGLNVHVLPFFKFYRGAEGKVCSFS 176 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +3 Query: 135 ATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLD 314 A WC PCK I P ++A+ ++E+N+ + PT VF+K+G+++D Sbjct: 17 APWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEF-SNEWNVEATPTVVFLKDGRQMD 75 Query: 315 EFSGA 329 + GA Sbjct: 76 KLVGA 80 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +3 Query: 105 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 278 GD+ V ++DF ATWCGPC ++ +L+ +A E A + + +P Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 Query: 279 TFVFV 293 T F+ Sbjct: 151 TLFFI 155 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 296 +V F A WC P + +E+A AS+ + +MPTF+F+K Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEV-ASQLEVKAMPTFLFLK 85 Query: 297 NGKKLDEFSGANVD 338 +G +D+ GAN D Sbjct: 86 DGNAMDKLVGANPD 99 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 41.5 bits (93), Expect = 4e-04 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 2/71 (2%) Frame = -2 Query: 503 KLISSN-SLQTLKTFFIHLLKTYTC-FFFLIPX*FPSAAAYNFSLYLLVFKDSCFEFVDV 330 KL+S+N S + F++ LLKTY C FFFL+ SA A F+L+ L + + E Sbjct: 108 KLLSNNHSADSSSVFYLRLLKTYVCNFFFLL-----SANASAFALFFLAY--NTLEAFGF 160 Query: 329 SAREFVQFLAI 297 S+R F FL++ Sbjct: 161 SSRNFYTFLSL 171 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 6/76 (7%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 281 +V++F A WCG C+ + P+ ++ A+E+ A+EY I PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 282 FVFVKN-GKKLDEFSG 326 ++N GK + +++G Sbjct: 109 LKILRNGGKSVQDYNG 124 Score = 37.5 bits (83), Expect = 0.007 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = +3 Query: 42 KPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 188 K I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 361 KKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 40.7 bits (91), Expect = 8e-04 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +3 Query: 114 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 293 +V+++F A WCG CK + P +++A + A +Y I PT Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVF 109 Query: 294 KNGKKLDEFSGA 329 GK ++ GA Sbjct: 110 VPGKAPIDYQGA 121 Score = 33.9 bits (74), Expect = 0.089 Identities = 19/84 (22%), Positives = 33/84 (39%), Gaps = 2/84 (2%) Frame = +3 Query: 42 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXX 215 +P S+ + S DDL ++L +++F A WCG CK + P+ A + Sbjct: 160 EPSASVELNASNFDDLVIE----SNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKL 215 Query: 216 XXXXXXXXXXXASEYNINSMPTFV 287 S + + PT + Sbjct: 216 GHVNCDVEQSIMSRFKVQGFPTIL 239 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 40.7 bits (91), Expect = 8e-04 Identities = 18/72 (25%), Positives = 37/72 (51%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 296 V++ F A WCGPC+ + P L+++ +E ++I+ +PT + K Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFK 289 Query: 297 NGKKLDEFSGAN 332 G+++ + +GA+ Sbjct: 290 GGEQMAKVTGAD 301 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 281 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 282 F-VFVKNGKKLDEFSG 326 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +3 Query: 72 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 188 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 281 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 282 F-VFVKNGKKLDEFSG 326 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +3 Query: 72 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 188 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/72 (22%), Positives = 32/72 (44%) Frame = +3 Query: 114 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 293 +V+++F A WCG C+ + P +++A+ + + +Y + PT Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVF 107 Query: 294 KNGKKLDEFSGA 329 GK ++ GA Sbjct: 108 VPGKPPIDYQGA 119 Score = 35.9 bits (79), Expect = 0.022 Identities = 21/90 (23%), Positives = 36/90 (40%), Gaps = 2/90 (2%) Frame = +3 Query: 42 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXX 215 +P S+ + S D+L T E L +++F A WCG CK + P+ + A + Sbjct: 161 EPSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKL 216 Query: 216 XXXXXXXXXXXASEYNINSMPTFVFVKNGK 305 S + + PT + + K Sbjct: 217 GHVNCDAEQSIKSRFKVQGFPTILVFGSDK 246 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLD---EIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 287 + +DF A WCG CK + P+LD I A++ A + I++ PT + Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLM 111 Query: 288 FVKNGKKLDEFSGANVD 338 +G ++ + D Sbjct: 112 LYNHGVPMEYYGPRKAD 128 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 37.9 bits (84), Expect = 0.005 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 293 VVI +MA WC C + PKL+++AAE S + MPT Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNAVPYRLVSRAGVTKMPTIQLW 160 Query: 294 KNGKKLDEFSGAN 332 ++G+K E G + Sbjct: 161 RDGQKQAEVIGGH 173 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 37.5 bits (83), Expect = 0.007 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 284 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 285 VFVKNGK 305 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +3 Query: 111 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 290 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 291 VKNGKKLDE 317 G K E Sbjct: 520 FPAGNKTSE 528 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 37.5 bits (83), Expect = 0.007 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 284 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 285 VFVKNGK 305 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +3 Query: 111 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 290 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 291 VKNGKKLDE 317 G K E Sbjct: 520 FPAGNKTSE 528 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 37.5 bits (83), Expect = 0.007 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 293 ++I++MA+WC C + PKL+++AAE NI+ MPT Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTIQLW 180 Query: 294 KNGKKLDEFSGAN 332 K + +E G + Sbjct: 181 KEDEMKEEVIGGH 193 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 37.5 bits (83), Expect = 0.007 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +3 Query: 117 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 296 VV+ F A+WC K + +A + + Y++ ++P FVF K Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEI-SEAYSVAAVPYFVFFK 82 Query: 297 NGKKLDEFSGAN 332 +GK +D GA+ Sbjct: 83 DGKTVDTLEGAD 94 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +3 Query: 105 GDKLVVIDFMATWCGPCKMIGP---KLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 275 G KL+V+D CGPC + P KL +E + N+ + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 276 PTFVFVKNGKKLDEFSGA 329 PTF+F+++G+ + G+ Sbjct: 266 PTFLFIRDGEIRGRYVGS 283 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/73 (21%), Positives = 28/73 (38%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 287 + +++F A WCG C+ + P+ A E+ A +Y I PT Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVF 175 Query: 288 FVKNGKKLDEFSG 326 +G+ + G Sbjct: 176 LFVDGEMRKTYEG 188 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 36.7 bits (81), Expect = 0.013 Identities = 24/85 (28%), Positives = 39/85 (45%) Frame = +3 Query: 75 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXAS 254 DD+K+ + A VI++ A+WCG C I P +++ + Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFSKLKFVYADIDECPE---T 88 Query: 255 EYNINSMPTFVFVKNGKKLDEFSGA 329 +I PTF F ++G+K+DE GA Sbjct: 89 TRHIRYTPTFQFYRDGEKVDEMFGA 113 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 35.9 bits (79), Expect = 0.022 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = +3 Query: 51 MSIHIKD--SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 224 MS +KD S + L +G LV + F A+WC K + +A + Sbjct: 1 MSGTVKDIVSKEELDNLRHSGAPLV-LHFWASWCDASKQMDQVFSHLATDFPRAHFFRVE 59 Query: 225 XXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 332 + Y++ +P FVF K+GK +D GA+ Sbjct: 60 AEEHPEI-SEAYSVALVPYFVFFKDGKTVDTLEGAD 94 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 35.5 bits (78), Expect = 0.029 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 281 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 282 F-VFVKNGKKLDEFSG 326 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 Score = 34.7 bits (76), Expect = 0.051 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAA 191 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 35.5 bits (78), Expect = 0.029 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 281 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 282 F-VFVKNGKKLDEFSG 326 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 Score = 34.7 bits (76), Expect = 0.051 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 108 DKLVVIDFMATWCGPCKMIGPKLDEIAA 191 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 34.3 bits (75), Expect = 0.067 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 60 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEI 185 ++ D K +++ K +++ F A WC PC+ PKL E+ Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEV 388 Score = 32.7 bits (71), Expect = 0.21 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 111 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 197 K + + F A WCGPC+ P+L E+ E+ Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNEL 72 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 33.5 bits (73), Expect = 0.12 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +3 Query: 66 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 218 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 163 Query: 219 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 323 A I ++P F F KNG L+ F+ Sbjct: 164 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 198 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 33.5 bits (73), Expect = 0.12 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +3 Query: 66 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 218 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 150 Query: 219 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 323 A I ++P F F KNG L+ F+ Sbjct: 151 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 185 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +3 Query: 123 IDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVK 296 + F WC CK +G +++ M A ++ I+S PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 297 NGKKLDEFSG 326 NG+++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +3 Query: 123 IDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVK 296 + F WC CK +G +++ M A ++ I+S PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 297 NGKKLDEFSG 326 NG+++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +3 Query: 123 IDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVK 296 + F WC CK +G +++ M A ++ I+S PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 297 NGKKLDEFSG 326 NG+++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 31.9 bits (69), Expect = 0.36 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +3 Query: 69 DSDDLKTRLA-EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXX 245 D D L +A + G+ + + F A+WC + + PK D +++ Sbjct: 60 DGDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPS 119 Query: 246 XASEYNINSMPTFVFV 293 S Y I+S+P+ + V Sbjct: 120 VFSRYGIHSLPSILMV 135 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 31.9 bits (69), Expect = 0.36 Identities = 17/82 (20%), Positives = 32/82 (39%) Frame = +3 Query: 90 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNIN 269 +L +++++ + + CGPC+ + P L+++ E A I Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIM 495 Query: 270 SMPTFVFVKNGKKLDEFSGANV 335 P F KN + L SG + Sbjct: 496 GTPCVQFFKNKEMLRTISGVKM 517 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 66 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 164 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 125 >At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 277 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 548 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 456 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 60 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 90 >At4g30280.1 68417.m04304 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 282 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 548 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 456 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 65 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 95 >At1g65310.1 68414.m07406 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 282 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 548 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 456 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 65 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 95 >At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 421 KKKKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 531 K K HV + + +KN++ N +N C + CK Sbjct: 327 KGKSHVQIQDIKLKNIYGTSNNIVAVNLQCSKSFPCK 363 >At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 421 KKKKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 531 K K HV + + +KN++ N +N C + CK Sbjct: 327 KGKSHVQIQDIKLKNIYGTSNNIVAVNLQCSKSFPCK 363 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 111 KLVVIDFMATWCGPCKMIGPKL 176 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 111 KLVVIDFMATWCGPCKMIGPKL 176 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g02330.1 68417.m00317 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 573 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -3 Query: 394 LRTTLVSIYLCLRIVVLSLSTLAPENSSS 308 L+ LV+++L L+ + ++ TL P NSSS Sbjct: 4 LKLFLVTLFLSLQTLFIASQTLLPSNSSS 32 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 376 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTKTNVG 275 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = +3 Query: 105 GDKLVVIDFMATWCGPCKMIGPKLDEIAA---EMXXXXXXXXXXXXXXXXXASEYNINSM 275 G++ V++ A WC + P+ E A E+ ASE I Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 276 PTFVFVKNGKKLDEFSGANVD 338 PT + NG L G++ + Sbjct: 153 PTLLLFVNGTSLTYNGGSSAE 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,071,991 Number of Sequences: 28952 Number of extensions: 215264 Number of successful extensions: 697 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -