BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I11 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPACUNK4.12c |mug138||metallopeptidase|Schizosaccharomyces pombe... 58 1e-09 SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 29 0.59 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 26 5.5 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 26 5.5 SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosacchar... 25 7.2 SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain p... 25 9.5 >SPACUNK4.12c |mug138||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 57.6 bits (133), Expect = 1e-09 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = +3 Query: 504 ACALCVGVGSYSDPAEIQGLAHFVXHMVFMGSEKYPKENEFDAFIXKXGG 653 + A+ V +GS S+P E+ GLAHF H++FMG++KYP ENE+ ++ G Sbjct: 47 SAAIDVHIGSQSNPRELLGLAHFCEHLLFMGTKKYPDENEYRKYLESHNG 96 >SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 29.1 bits (62), Expect = 0.59 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 558 GLAHFVXHMVFMGSEKYPKENEFDAFIXKXGG 653 G H + H+ FMGS+KYP F + G Sbjct: 58 GCPHTLEHLCFMGSKKYPMNGILTKFAGRACG 89 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 25.8 bits (54), Expect = 5.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 503 SLRPLCWCGQLQRP 544 SL LCWCG+ ++P Sbjct: 254 SLHYLCWCGKQEKP 267 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 25.8 bits (54), Expect = 5.5 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +3 Query: 165 KPEIKVLNNRSKRPVTMFHXKENVEVLPEPIKSEADK 275 +P I+++ N ++P+ F + LP PI+ K Sbjct: 771 EPSIRIICNFCRKPIFPFSNRNECNNLPTPIQRGVSK 807 >SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = -2 Query: 278 LFISFRFNGFREHFNILFXMEHSHWPFRTVI*HLNFGFKFRCPLKTTSF 132 LF++F + + +++ WPF+ V+ + F F P K SF Sbjct: 106 LFLAFILSLCNTRSRVAIKIQNGLWPFKIVLWFVLGIFSFFIPTKFLSF 154 >SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 607 Score = 25.0 bits (52), Expect = 9.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 144 FQRTPKFKPEIKVLNNRSKRPVTMFHXKENVEVLPEPI 257 + R PK K K N S PVT ++ K+ +L EPI Sbjct: 43 YPREPKNK---KKANKGSTAPVTFYYTKDIQYLLHEPI 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,362,261 Number of Sequences: 5004 Number of extensions: 41816 Number of successful extensions: 86 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -