BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I11 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 8e-21 SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) 29 2.5 >SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 97.5 bits (232), Expect = 8e-21 Identities = 46/86 (53%), Positives = 52/86 (60%) Frame = +3 Query: 396 DXNSDPESDGGKSVQSATSDHHGTTXRNDFDEXKLXACALCVGVGSYSDPAEIQGLAHFV 575 D SD DG +S H + KL A ALC+G GS+SDP +I GLAHF+ Sbjct: 138 DDESDVSMDGDESDDEEEGPHKPEEKHAKGKDTKLAAAALCIGTGSFSDPDDIPGLAHFL 197 Query: 576 XHMVFMGSEKYPKENEFDAFIXKXGG 653 HMVFMGSEKYP EN FDAFI K GG Sbjct: 198 EHMVFMGSEKYPDENSFDAFIKKHGG 223 Score = 33.5 bits (73), Expect = 0.15 Identities = 29/130 (22%), Positives = 49/130 (37%) Frame = +3 Query: 102 LIKHTFAAMSKRSGFQRTPKFKPEIKVLNNRSKRPVTMFHXKENVEVLPEPIKSEADKKL 281 L+ F +SKR G + + ++S V+ + + + + + + + Sbjct: 16 LVVTFFLPLSKRKGQSHSQSVSQSVSQSVSQS---VSQSVSQSVSQSVSQSVSQSVSQSV 72 Query: 282 YKTIRLXNGLTALLISDPSRPAVTXXXXXXXXXXXXXXDXNSDPESDGGKSVQSATSDHH 461 + I L NGLTALLISD VT D + + D + + SD Sbjct: 73 GRVITLPNGLTALLISDTD--TVTTRPPQSSSHSETDDDDSGEESGDEDEEKTESESDDD 130 Query: 462 GTTXRNDFDE 491 T + DE Sbjct: 131 DKTEKYSDDE 140 >SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) Length = 1710 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +3 Query: 6 SCMALRNYTSINVKFFV*-IIHSKNF*ASCRVVLIKHTFAAMSKRSGFQRTPKFKPEIKV 182 S + + NY I+ ++ I+ N+ SCR +L+ + + + +SG R P + P K+ Sbjct: 305 SSIYIDNYIYIDNYIYIDNYIYIDNYSDSCRYLLVS-SCSCRAGKSGSSRLPSWSPRQKL 363 Query: 183 LNNRS 197 NN + Sbjct: 364 SNNNN 368 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,627,478 Number of Sequences: 59808 Number of extensions: 320676 Number of successful extensions: 566 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -