BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I09 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 24 1.2 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 1.6 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 23 2.9 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 23 2.9 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 6.7 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 494 SRRGIFEKLQQLAFPLSHRLPMF 562 S + EKLQ A L+HR P F Sbjct: 609 SNPSLEEKLQIFALQLTHRAPTF 631 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 512 EKLQQLAFPLSHRLPMFAFSYSESFPEXGWHVYEPI 619 EKL LA + ++ P +E + E G+H E + Sbjct: 16 EKLNTLAISVMNQWPGVRLLVTEGWDEEGYHTPESL 51 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -2 Query: 527 AAAVFQIYHDVNDSXVCVQXLSSSYPYKKFXFHMSFHL 414 A V +++ ++ + V + L+ PYK ++ HL Sbjct: 111 ALKVIEVFKNIEEVDVAFRSLAVWVPYKHLYVNILIHL 148 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -2 Query: 527 AAAVFQIYHDVNDSXVCVQXLSSSYPYKKFXFHMSFHL 414 A V +++ ++ + V + L+ PYK ++ HL Sbjct: 111 ALKVIEVFKNIEEVDVAFRSLAVWVPYKHLYVNILIHL 148 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 567 SVILKVSLXMVGMC 608 S++LKVS ++G C Sbjct: 70 SILLKVSSLLIGFC 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,766 Number of Sequences: 336 Number of extensions: 2922 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -