BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I01 (503 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0370 + 17017567-17018335,17018634-17018914,17019012-170192... 29 2.1 03_02_0990 - 13028011-13028114,13028182-13028554,13029488-130296... 28 4.9 06_03_1510 + 30665857-30666038,30666137-30666236,30666358-306664... 27 8.6 >09_04_0370 + 17017567-17018335,17018634-17018914,17019012-17019204, 17019635-17019798 Length = 468 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 Query: 142 LALLSCSCAGATSIALSLL 86 L+LL C C+GA SI L+LL Sbjct: 188 LSLLGCDCSGAVSIELALL 206 >03_02_0990 - 13028011-13028114,13028182-13028554,13029488-13029631, 13030389-13030396,13030634-13030711,13030968-13031132, 13031414-13031471 Length = 309 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -2 Query: 196 LFTYTCFRYVXGVMWQYTLALLSCSCAGATSIALSLLHL 80 +FT TC + G +W + C + I ++++HL Sbjct: 268 IFTKTCGNGIEGRIWYLRTVNIVLGCVPSAQICITMMHL 306 >06_03_1510 + 30665857-30666038,30666137-30666236,30666358-30666438, 30666514-30666618,30666722-30666916,30667440-30667501, 30667870-30667885,30668007-30668068,30668933-30668951 Length = 273 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -1 Query: 149 IHTCLAFVFLCWSYFDSFVITTPIFKWLDILTTRWQRYNN 30 +H CLAF+F ++ +F + + IL +RW R+++ Sbjct: 12 LHCCLAFLFKFLAFLQAFAAVSALLYAAWIL-SRWARHHH 50 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,791,998 Number of Sequences: 37544 Number of extensions: 216725 Number of successful extensions: 446 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -