BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_H23 (423 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containi... 30 0.74 At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 29 1.3 At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containi... 28 3.0 At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / po... 28 3.0 At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containi... 27 4.0 At3g26580.1 68416.m03318 expressed protein 27 5.2 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) n... 27 5.2 At2g14570.1 68415.m01632 SWIM zinc finger family protein 27 5.2 At5g19610.1 68418.m02334 sec7 domain-containing protein similar ... 27 6.9 At4g20290.1 68417.m02963 expressed protein 27 6.9 At2g37380.1 68415.m04584 expressed protein 27 6.9 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 26 9.1 At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containi... 26 9.1 >At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 763 Score = 29.9 bits (64), Expect = 0.74 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +1 Query: 112 GLLNAV-IKRNIIVALALSGVA---GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 270 GL+NAV I L + G+ GF + +GN YA+F DA+K FE++ Sbjct: 377 GLINAVKCNEQIKEGLKIHGLCIKTGFVSEPSVGNSFITLYAKFEALEDAKKAFEDI 433 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 175 GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGL 285 GF F +GN Y +T DA K F+EM ++ + Sbjct: 143 GFDFDVYVGNNLIHLYGTCKKTSDARKVFDEMTERNV 179 >At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 850 Score = 27.9 bits (59), Expect = 3.0 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 151 ALALSGVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 270 A ALS V GF +GN Y+ DA K F+EM Sbjct: 149 AHALSLVTGFISNVFVGNALVAMYSRCRSLSDARKVFDEM 188 >At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / potassium channel protein identical to SKOR [Arabidopsis thaliana] gi|3810676|emb|CAA11280; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 828 Score = 27.9 bits (59), Expect = 3.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 204 ITNELLEGKTSDARESQSNNNVTFDDGVEE 115 I N LLEGK S+ R Q +++TF +E Sbjct: 516 ILNNLLEGKESNVRIKQLESDITFHISKQE 545 >At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 792 Score = 27.5 bits (58), Expect = 4.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 169 VAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKK 279 V G + L+G+ + Y +F+R DA K F+ M +K Sbjct: 147 VDGCDSELLLGSNIVKMYFKFWRVEDARKVFDRMPEK 183 >At3g26580.1 68416.m03318 expressed protein Length = 350 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 196 IGNERKRKYAEFYRTYDAEKEFEEMRKK 279 + ERKR+ EF+ T + E++ EE++ K Sbjct: 113 VEKERKRRAKEFHDTKELERKAEELQYK 140 >At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma-associated protein A domain, PF01857 retinoblastoma-associated protein B domain Length = 1013 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 172 AGFTFKQLIGNERKRKYAEFYRTYDAEKE 258 A F L+ KR + EF+ TYDA E Sbjct: 149 ANFVHLSLLSKYYKRGFREFFLTYDANAE 177 >At2g14570.1 68415.m01632 SWIM zinc finger family protein Length = 435 Score = 27.1 bits (57), Expect = 5.2 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 215 ESMLNSTEPMMLKRNLRRCARRVYSNPAKYELSXC 319 + +LN+ E + K R CAR +Y N K LS C Sbjct: 275 KGLLNAIERKLPKVEYRMCARHIYGNLKK--LSPC 307 >At5g19610.1 68418.m02334 sec7 domain-containing protein similar to SP|Q42510 Pattern formation protein EMB30 (GNOM) {Arabidopsis thaliana}; contains Pfam profile PF01369: Sec7 domain Length = 1375 Score = 26.6 bits (56), Expect = 6.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 6 DCDPLCN*AFLTFSKIIIRH 65 DCDP+C F K++ RH Sbjct: 391 DCDPMCRNIFEETGKVLCRH 410 >At4g20290.1 68417.m02963 expressed protein Length = 118 Score = 26.6 bits (56), Expect = 6.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 187 KQLIGNERKRKYAEFYRTYDAEKEFEEMRKKG 282 K+ G E+KR+ + D E+E EE R+KG Sbjct: 13 KERGGEEKKRRRSALNSEEDEEEEEEEGRRKG 44 >At2g37380.1 68415.m04584 expressed protein Length = 321 Score = 26.6 bits (56), Expect = 6.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 39 TFSKIIIRHGWRKCSIDSEQASDARS 116 +FS +I RH KCS S +S A S Sbjct: 228 SFSGVIQRHSQAKCSTSSSSSSSASS 253 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 26.2 bits (55), Expect = 9.1 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 228 FSILSLALITNELLEGKTSDARESQSNNNVTFDDGVEETSHLRLARCRYCT 76 F + ++ + L+ G+ ES+S +++TF DG + L Y T Sbjct: 60 FEYFNALVLRDWLIRGRRLSESESESESSLTFSDGNSTSRISSLGFLHYTT 110 >At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 613 Score = 26.2 bits (55), Expect = 9.1 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 172 AGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQSC 297 AG ++ N YA+F R Y K F+EM + C Sbjct: 76 AGADCDTVVSNSLISMYAKFSRKYAVRKVFDEMLHRDTVSYC 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,863,626 Number of Sequences: 28952 Number of extensions: 114587 Number of successful extensions: 385 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 655255392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -