BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_H15 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57836| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 >SB_57836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 226 LFVLNIFIDLXKFNLVKNKTIKFIK*PNFKLNESYSLSW 110 L L FI L K L NK+++F+ +F N++ SW Sbjct: 324 LISLGYFIGLKKSTLAPNKSVRFLGIDSFIDNQALQFSW 362 >SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 866 Score = 29.1 bits (62), Expect = 3.3 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 8/71 (11%) Frame = +2 Query: 425 NLFG*TLGAYXNENLQFCYDLLCFSKTSFLGGRYVELGNLCYXYNLCHCIFPS------- 583 NLF +GA +L +L CFS S + G++ G C + LC + S Sbjct: 604 NLF---VGALAVSDLLLIVNLACFSSPSVVLGKWPFSGFFCQFHGLCIALLASASLLLMA 660 Query: 584 ITAAN-FIQIV 613 +TA N ++Q+V Sbjct: 661 VTAVNRYLQVV 671 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,006,718 Number of Sequences: 59808 Number of extensions: 243138 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -