BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_H15 (654 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D38553-1|BAA07556.1| 747|Homo sapiens HCAP-H protein. 35 0.29 BC024211-1|AAH24211.1| 741|Homo sapiens non-SMC condensin I com... 33 0.89 >D38553-1|BAA07556.1| 747|Homo sapiens HCAP-H protein. Length = 747 Score = 34.7 bits (76), Expect = 0.29 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -2 Query: 590 Q*WREKCNDTDYTYNIDYPTQHTAPPKTKFLRNTVNHSKIVSFHXDKLQEFNQTN 426 Q WR TD+ YN+D Q P T+ L+ H ++ + H +++++++ N Sbjct: 507 QNWRATTLPTDFNYNVDTLVQLHLKPGTRLLKMAQGH-RVETEHYEEIEDYDYNN 560 >BC024211-1|AAH24211.1| 741|Homo sapiens non-SMC condensin I complex, subunit H protein. Length = 741 Score = 33.1 bits (72), Expect = 0.89 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -2 Query: 590 Q*WREKCNDTDYTYNIDYPTQHTAPPKTKFLRNTVNHSKIVSFHXDKLQEFNQTN 426 Q WR TD+ YN+D Q P T+ L+ H + + H +++++++ N Sbjct: 501 QNWRATTLPTDFNYNVDTLVQLHLKPGTRLLKMAQGH-RAETEHYEEIEDYDYNN 554 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,964,876 Number of Sequences: 237096 Number of extensions: 1147694 Number of successful extensions: 1456 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1456 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -