BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_H12 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0261 + 1926458-1926523,1926959-1927144 48 6e-06 12_02_0201 + 15456805-15457154,15457246-15457450,15457959-15457994 28 7.4 >06_01_0261 + 1926458-1926523,1926959-1927144 Length = 83 Score = 48.0 bits (109), Expect = 6e-06 Identities = 18/63 (28%), Positives = 39/63 (61%) Frame = +1 Query: 439 AVLFLLIYYIITLSDLECDYLNAQECCDKLNYWLVPKYIAHTLITFLLVTHGQLVLFFLN 618 A++ L+IY ++ L+DLE DY+N + ++N ++P+++ ++ L + G +F L+ Sbjct: 14 ALIVLVIYQLMCLADLEFDYINPFDSSSRINKVVIPEFVLQAALSVLFLLSGHWAMFLLS 73 Query: 619 LPL 627 P+ Sbjct: 74 APM 76 >12_02_0201 + 15456805-15457154,15457246-15457450,15457959-15457994 Length = 196 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 415 SLCLIDTGAVLFLLIYYIITLSDLECDYLNAQECCDKLNYWL 540 SLC T ++ ++ I+T++D CD Q+C KL+Y+L Sbjct: 3 SLC--GTMIIILAMLPAILTMADPYCDCDCPQQCEVKLHYYL 42 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,308,650 Number of Sequences: 37544 Number of extensions: 269757 Number of successful extensions: 491 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -