SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P02_F_H07
         (451 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC029819-1|AAH29819.1|  483|Homo sapiens dual oxidase maturation...    29   7.3  

>BC029819-1|AAH29819.1|  483|Homo sapiens dual oxidase maturation
           factor 1 protein.
          Length = 483

 Score = 29.1 bits (62), Expect = 7.3
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 2/55 (3%)
 Frame = +1

Query: 94  EQKLKEHGASSCISGKRGRRCCNIWHWGSVD-SISGSRARF-QLSGNSGRKHSRC 252
           E++  EH   S     RGR    +W WGS +    G RA   +L  NSG K   C
Sbjct: 396 EERWAEHTGDSP-RPLRGRGTGRLWRWGSKERRACGVRAMLPRLVSNSGLKRPSC 449


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,504,410
Number of Sequences: 237096
Number of extensions: 1179656
Number of successful extensions: 1976
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1928
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1976
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 3701294870
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -