BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_H07 (451 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15840.1 68417.m02409 expressed protein 29 1.1 At4g27370.1 68417.m03929 myosin family protein contains Pfam pro... 28 2.5 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 4.4 At5g07790.1 68418.m00892 expressed protein 27 5.9 At4g16141.1 68417.m02446 expressed protein contains 1 predicted ... 27 5.9 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 190 ISGSRARFQLSGNSGRKHSRCCTSILRKFSG 282 +SGS FQ S NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 >At4g27370.1 68417.m03929 myosin family protein contains Pfam profiles: PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif Length = 1126 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 40 LNFLNQHXXFYTCAIARREQKLKEH-GASSCISGKRGR 150 ++ LN+ F KLK+H A+SC G+RGR Sbjct: 590 VSLLNEESNFPKATDTTFANKLKQHLNANSCFKGERGR 627 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.5 bits (58), Expect = 4.4 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 100 KLKEHGASSCISGKRGRRCCNIWHWGSVDSISG 198 K+ EH ASS R N W GSV ISG Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457 >At5g07790.1 68418.m00892 expressed protein Length = 616 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 121 SSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSI 264 S + KR RR + G+ +S + A +S SGR+ + C TS+ Sbjct: 411 SGRVKRKRSRRISLVAE-GNYQQVSAAEAIVDISRKSGRETAACITSL 457 >At4g16141.1 68417.m02446 expressed protein contains 1 predicted transmembrane domain; contains a partial Pfam PF00320: GATA zinc finger profile Length = 226 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 396 KTEKVRSWSDVENG*CLASPHGVGATMAAAVNCDT 292 K E SDV+NG C +S G G T V+C T Sbjct: 11 KLESAGDSSDVDNGNCSSSGSG-GDTKKTCVDCGT 44 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,741,738 Number of Sequences: 28952 Number of extensions: 160040 Number of successful extensions: 346 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -