BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_H05 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 35 6e-04 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 35 8e-04 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 30 0.017 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 27 0.21 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 1.1 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 1.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.6 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 4.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 5.9 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.8 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 35.1 bits (77), Expect = 6e-04 Identities = 34/118 (28%), Positives = 55/118 (46%) Frame = +3 Query: 114 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKS 293 M K++ N+ VI HVD GKST T L+ K G I R E +F + E + + K Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KF-EKEAQEMGKG-SFKY 56 Query: 294 TAISMFFELEXKDLVFITNPDXREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + E + + I + ++ K + + +ID+PGH DF + D A+ Sbjct: 57 AWVLDKLKAERERGITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 34.7 bits (76), Expect = 8e-04 Identities = 34/118 (28%), Positives = 55/118 (46%) Frame = +3 Query: 114 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKS 293 M K++ N+ VI HVD GKST T L+ K G I R E +F + E + + K Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KF-EKEAQEMGKG-SFKY 56 Query: 294 TAISMFFELEXKDLVFITNPDXREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + E + + I + ++ K + + +ID+PGH DF + D A+ Sbjct: 57 AWVLDKLKAERERGITIDIALWKFETAK-YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +3 Query: 372 EKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPI 551 E G + +D+PGH F S +TD + QT + A ++ I Sbjct: 190 ESGERVTFLDTPGHAAFISMRHRGAHITDIVVLVVAADDGVKEQTLQSIEMAKDAKVPII 249 Query: 552 LFMNKMDR 575 + +NK+D+ Sbjct: 250 VAINKIDK 257 Score = 29.5 bits (63), Expect = 0.029 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 141 MSVIAHVDHGKSTLTDSL 194 ++++ HVDHGK+TL D+L Sbjct: 148 VTIMGHVDHGKTTLLDAL 165 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 26.6 bits (56), Expect = 0.21 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 84 ISRLXEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSL 194 +S+L + + ++ N+ I HV HGKST+ ++ Sbjct: 26 VSKLTALSREVISRQATINIGTIGHVAHGKSTIVKAI 62 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 381 FLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + +ID+PGH DF + D A+ Sbjct: 12 YYVTIIDAPGHRDFIKNMITGTSQADCAV 40 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 381 FLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + +ID+PGH DF + D A+ Sbjct: 28 YYVTIIDAPGHRDFIKNMITGTSQADCAV 56 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/21 (38%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +3 Query: 3 PFSKRTPLLAYGSW-FNXTKI 62 PF ++T ++ +GSW FN ++ Sbjct: 159 PFDQQTCIMKFGSWTFNGDQV 179 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 3 PFSKRTPLLAYGSW 44 PF ++T +L +GSW Sbjct: 161 PFDEQTCVLKFGSW 174 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = -3 Query: 521 TQYCFSLYTHTRHTVNNHKGSISDTECSCYFRREINVSR*VNQV 390 T C S Y +RH N + + CS RE R +Q+ Sbjct: 227 TSSCHSRYEDSRHEDRNSYRNDGERSCSRDRSREYKKDRRYDQL 270 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 484 TQSTTTRAP-SVTRSAAVTSEEKSTC 410 + STTT +P + T+S V + STC Sbjct: 324 SSSTTTTSPMTSTKSTIVRNHLNSTC 349 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 3 PFSKRTPLLAYGSW 44 PF ++T ++ +GSW Sbjct: 157 PFDEQTCVMKFGSW 170 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 276 CITIKSTAISMFF 314 C T+K +A+ M+F Sbjct: 688 CATVKGSAVDMYF 700 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,776 Number of Sequences: 438 Number of extensions: 3029 Number of successful extensions: 23 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -