BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_H03 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30844| Best HMM Match : zf-C2H2 (HMM E-Value=0.0028) 53 2e-07 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 39 0.004 SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) 35 0.050 SB_21518| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.15 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_50607| Best HMM Match : Vicilin_N (HMM E-Value=0.88) 31 0.81 SB_37408| Best HMM Match : Vicilin_N (HMM E-Value=0.11) 31 0.81 SB_5137| Best HMM Match : Phage_integrase (HMM E-Value=0.11) 31 0.81 SB_4357| Best HMM Match : Vicilin_N (HMM E-Value=0.11) 31 0.81 SB_54316| Best HMM Match : Vicilin_N (HMM E-Value=1.4) 31 0.81 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_31148| Best HMM Match : zf-C2H2 (HMM E-Value=8.1) 31 0.81 SB_25237| Best HMM Match : Phage_integrase (HMM E-Value=0.2) 31 0.81 SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) 31 1.1 SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21889| Best HMM Match : Mak16 (HMM E-Value=3.8) 30 1.9 SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_6270| Best HMM Match : Vicilin_N (HMM E-Value=0.11) 29 2.5 SB_29378| Best HMM Match : NHL (HMM E-Value=8.3) 29 3.3 SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.7 SB_46754| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-29) 28 5.7 SB_40773| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_27421| Best HMM Match : Peptidase_M35 (HMM E-Value=7.1) 28 5.7 SB_8216| Best HMM Match : Metallothio_2 (HMM E-Value=0.71) 28 7.6 >SB_30844| Best HMM Match : zf-C2H2 (HMM E-Value=0.0028) Length = 401 Score = 52.8 bits (121), Expect = 2e-07 Identities = 20/44 (45%), Positives = 28/44 (63%) Frame = +3 Query: 309 YENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHDSYFAVMAEK 440 +++HY H C CKK PS H L++HI ENHD+ F ++A K Sbjct: 355 FDSHYKTCHWNVCRYCKKSFPSNHLLEIHILENHDTLFQMIARK 398 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +3 Query: 267 SIPGCKHIADTLLDYENHYNATHR----YSCAQCKKVLPSPHFLDLHIQEN 407 S P C + T + E H A+H Y+C+QC K +PH+L LH++ + Sbjct: 451 SCPTCDRVFQTNANLERH-QASHSEERPYTCSQCDKAFKAPHYLALHMKSH 500 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 312 ENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHDSY 419 + H NA H + C+ C+K L HI+ H + Sbjct: 402 KKHTNADHPHECSTCQKTFEGKLSLISHIKSEHPEF 437 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 279 CKHIADTLLDYENHYN-ATHRYSCAQCKKVLPSPHFLDLHIQENHDSYF 422 C+ T L+Y H N YSC +C KV + L H + ++ F Sbjct: 306 CQVTFSTELEYTVHKNDCNSHYSCDECGKVYKTAKLLRTHAKIHNKQRF 354 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +3 Query: 240 NTQFKQTPCSIPGCKHIADT---LLDYENHYNATHRYSCAQCKKVLPSPHFLDLHI 398 NT K CS C + T L+ + A + C QC K L S ++L H+ Sbjct: 821 NTMTKSLKCS--HCDEMFPTRANLIAHHKEVQAKGNFKCEQCDKSLLSQYYLKRHL 874 >SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +3 Query: 267 SIPGCKHIADTLLDYENHYNATHR----YSCAQCKKVLPSPHFLDLHIQEN 407 S P C + T + E H A+H Y+C+QC K +PH+L LH++ + Sbjct: 383 SCPTCDRVFQTNANLERH-QASHSEERPYTCSQCDKAFKAPHYLALHMKSH 432 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 312 ENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHDSY 419 + H NA H + C+ C+K L HI+ H + Sbjct: 334 KKHTNADHPHECSTCQKTFEGKLSLISHIKSEHPEF 369 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 279 CKHIADTLLDYENHYN-ATHRYSCAQCKKVLPSPHFLDLHIQENHDSYF 422 C+ T L+Y H N YSC +C KV + L H + ++ F Sbjct: 238 CQVTFSTELEYTVHKNDCNSHYSCDECGKVYKTAKLLRTHAKIHNKQRF 286 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 36.7 bits (81), Expect = 0.016 Identities = 19/66 (28%), Positives = 27/66 (40%) Frame = +3 Query: 246 QFKQTPCSIPGCKHIADTLLDYENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHDSYFA 425 Q T C CK L D E H ++ H SC C+K+ L+ H+ + H Sbjct: 373 QTTTTKCEF--CKKEFTALEDLERHVSSNHDLSCIFCRKLFHGKSLLERHVSKRHKEGTK 430 Query: 426 VMAEKK 443 + KK Sbjct: 431 PLPSKK 436 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/65 (21%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 228 DGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS---CAQCKKVLPSPHFLDLHI 398 +G+ ++ C + NH H+ + C CKK + L+ H+ Sbjct: 337 EGHLSSNHSNVLLKCDSCNEMVTGKRALRNHMKKVHQTTTTKCEFCKKEFTALEDLERHV 396 Query: 399 QENHD 413 NHD Sbjct: 397 SSNHD 401 >SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 365 Score = 35.1 bits (77), Expect = 0.050 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 273 PGCKHIADTLLDYENHYNATHRYSCAQCKKVLPSPHFLDLHIQENH 410 P H++ + + + C CKKV +PH L++H++ +H Sbjct: 174 PSLDHVSPDRKKLKLESESQDTFDCMSCKKVFSTPHGLEVHVRRSH 219 >SB_21518| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 376 Score = 33.5 bits (73), Expect = 0.15 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 339 YSCAQCKKVLPSPHFLDLHIQENHDS 416 Y+C C+K+ +PH L++H++ +H S Sbjct: 208 YACKTCQKIFCTPHGLEVHVRRSHAS 233 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +3 Query: 309 YENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHD 413 ++N ++ Y C QC K+ S LD H++ H+ Sbjct: 165 HQNTHSGEKPYQCTQCDKLFGSQEILDRHVRAVHN 199 >SB_50607| Best HMM Match : Vicilin_N (HMM E-Value=0.88) Length = 385 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D + R V + +K+ CS PGC I L NH NA H+ S Sbjct: 41 EALSVFDLRAKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 95 >SB_37408| Best HMM Match : Vicilin_N (HMM E-Value=0.11) Length = 323 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D + R V + +K+ CS PGC I L NH NA H+ S Sbjct: 41 EALSVFDLRAKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 95 >SB_5137| Best HMM Match : Phage_integrase (HMM E-Value=0.11) Length = 834 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D + R V + +K+ CS PGC I L NH NA H+ S Sbjct: 41 EALSVFDLREKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 95 >SB_4357| Best HMM Match : Vicilin_N (HMM E-Value=0.11) Length = 406 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D + R V + +K+ CS PGC I L NH NA H+ S Sbjct: 52 EALSVFDLRAKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 106 >SB_54316| Best HMM Match : Vicilin_N (HMM E-Value=1.4) Length = 187 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D + R V + +K+ CS PGC I L NH NA H+ S Sbjct: 41 EALSVFDLRAKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 95 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 31.1 bits (67), Expect = 0.81 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -1 Query: 394 CRSKKCGEGRTFLH*AHEYLCVAL*WFS*SNSVSAM--CLHPGMLHGVCLNWV 242 C S CG G T H + Y C+ F+ N + + C +HG C N + Sbjct: 2754 CLSNPCGNGATCRHLVNNYTCICAVGFTGRNCLDDINECGSDPCVHGKCNNTI 2806 >SB_31148| Best HMM Match : zf-C2H2 (HMM E-Value=8.1) Length = 120 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D + R V + +K+ CS PGC I L NH NA H+ S Sbjct: 41 EALSVFDLRAKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 95 >SB_25237| Best HMM Match : Phage_integrase (HMM E-Value=0.2) Length = 845 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D + R V + +K+ CS PGC I L NH NA H+ S Sbjct: 41 EALSVFDLRAKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 95 >SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) Length = 1873 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 99 PKKMNAKSLLEKLKEYGVGKRM--LDDVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSI 272 P+K + L+ K +E G R L DV F+ D+ P R+ + VD YN ++ P Sbjct: 1575 PEKFPVRPLIIKTREVPQGPRSTKLQDV-FVGDR-PNRIFVAFVDSEGYNGSYRLNPFHF 1632 Query: 273 P 275 P Sbjct: 1633 P 1633 >SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 99 PKKMNAKSLLEKLKEYGVGKRM--LDDVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSI 272 P+K + L+ K +E G R L DV F+ D+ P R+ + VD YN ++ P Sbjct: 1361 PEKFPVRPLIIKTREVPQGPRSTKLQDV-FVGDR-PNRIFVAFVDSEGYNGSYRLNPFHF 1418 Query: 273 P 275 P Sbjct: 1419 P 1419 >SB_21889| Best HMM Match : Mak16 (HMM E-Value=3.8) Length = 336 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = +3 Query: 171 DVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 + L + D R V + +K+ CS PGC I L NH NA H+ S Sbjct: 41 EALSVFDLGAKRTKSEAVPEQRAKRTYKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 95 >SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 339 YSCAQCKKVLPSPHFLDLHIQENH 410 + C CKK+ PH L H+ H Sbjct: 518 HQCEHCKKIFNRPHHLKAHVNTTH 541 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = +3 Query: 252 KQTPCSIPGCKHIADTLLDYENHYNATHR---YSCAQCKKVLPSPHFLDLHIQENH 410 K+ P CK I H H+ + C +C+K P+ L H++ H Sbjct: 660 KEKPYKCDVCKKIFGLSSSLSRHIRTVHQDKAFKCERCEKKFSQPYHLTRHVKGCH 715 >SB_6270| Best HMM Match : Vicilin_N (HMM E-Value=0.11) Length = 535 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 249 FKQTPCSIPGCKHIADTLLDYENHYNATHRYS 344 +K+ CS PGC I L NH NA H+ S Sbjct: 176 YKRRVCSFPGCNLIVRRL---HNHLNAKHKLS 204 >SB_29378| Best HMM Match : NHL (HMM E-Value=8.3) Length = 255 Score = 29.1 bits (62), Expect = 3.3 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +3 Query: 105 KMNAKSLLEKLKEYGVGKRM--LDDVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIP 275 K + L+ K +E G R L DV F+ D+ P R+ I VD YN ++ P P Sbjct: 135 KFPVRPLIIKTREVPQGLRSTKLQDV-FVEDR-PNRIFIAFVDSEGYNGSYRHNPFHFP 191 >SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 4/66 (6%) Frame = +3 Query: 228 DGNYNTQFKQTPCSIPGCKHIADTLLDYENHYNATHR----YSCAQCKKVLPSPHFLDLH 395 D +YNT F C + D D H TH + C QC + +PS L +H Sbjct: 531 DRHYNTTF----IFCQNCHIMFDCEEDLAKH-KETHTTNMIFKCEQCDEYMPSHSKLLIH 585 Query: 396 IQENHD 413 +E HD Sbjct: 586 RKERHD 591 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 333 HRYSCAQCKKVLPSPHFLDLHIQENH 410 HRY C C++V SP H+++ H Sbjct: 508 HRYLCMFCEEVFLSPGVFHKHLKDRH 533 >SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2126 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 294 DTLLDYENHYNATHRYSCAQCKKVLPSPHFLDLHIQENH 410 + LL ++ H+N R C QC+ P L +H++ +H Sbjct: 663 NVLLFWQVHHNIKVR--CPQCRDSFDHPRVLSMHLKSHH 699 >SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 297 TLLDYENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHDS 416 TL+D+ +++ Y C++C K P L H++ + D+ Sbjct: 395 TLVDHIRTHSSERPYVCSECNKGFTHPSNLTSHMKTHSDN 434 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 306 DYENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHDSYFAVMAEK 440 D H ++ C +C+K+ SP+ L++H + H + EK Sbjct: 176 DKRVHLPRERKHECMECQKLFDSPNALEVHFR-THTGERPYLCEK 219 >SB_46754| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-29) Length = 487 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 291 ADTLLDYENHYNATHRYSCAQCKKVLPSPHFLDLHIQENHD 413 +++L D+EN + + C C K SP L H + D Sbjct: 96 SNSLFDHENRHTGELPFKCVVCGKAFISPQALGRHALVHSD 136 >SB_40773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 28.3 bits (60), Expect = 5.7 Identities = 21/71 (29%), Positives = 30/71 (42%) Frame = -3 Query: 296 ISYVFTSWYAARSLFKLGVIISIVHIVNSKSSWLFIMYKQNIIKHPFSYSIFFKLLQ*RF 117 +S T Y A G +I IV+ + L + + I HPF Y+ F + R Sbjct: 654 VSLTGTWHYGAVVCDAQGFLIFSFGIVSVWTMCLIAVNRYIAISHPFLYTKTFTASRMRI 713 Query: 116 CIHFFWLSAFL 84 I F WL +L Sbjct: 714 TIIFLWLLPWL 724 >SB_27421| Best HMM Match : Peptidase_M35 (HMM E-Value=7.1) Length = 556 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +3 Query: 105 KMNAKSLLEKLKEYGVGKRM--LDDVLFIHDKQPTRLGIYDVDDGNYNTQFKQTPCSIP 275 K + L+ K +E G R L DV F+ D+ P R+ + VD YN ++ P P Sbjct: 292 KFPVRPLIIKTREVPQGPRSTKLQDV-FVGDR-PNRIFVAFVDSEGYNGSYRHNPFHFP 348 >SB_8216| Best HMM Match : Metallothio_2 (HMM E-Value=0.71) Length = 628 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 291 ADTLLDYENHYNATHRYSCAQCK-KVL 368 +D LLD HY HR+ C++CK KVL Sbjct: 179 SDALLDTLEHYLRKHRF-CSECKSKVL 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,850,786 Number of Sequences: 59808 Number of extensions: 435565 Number of successful extensions: 1282 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1281 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -