BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G24 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 27 0.12 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 26 0.36 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.5 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 27.5 bits (58), Expect = 0.12 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +1 Query: 427 VDSVLDVVRKEAESCDCLQGIPT 495 +DS+++++R ++CD L G+ T Sbjct: 106 IDSIINIIRVRVDACDRLWGVDT 128 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 25.8 bits (54), Expect = 0.36 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +1 Query: 367 GQSGAGNNWAXGHYTEGAELVDSVLDVVRKEAES---CDCLQGIPTDTLARRRHRFRYGH 537 G SG ++ G + E +D+ L+ +R S GIP+ TL +R HR Sbjct: 396 GHSGQSSSHHHGSKSWTQEDMDAALEALRNHDMSLTKASATFGIPSTTLWQRAHRLGIDT 455 Query: 538 P 540 P Sbjct: 456 P 456 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 156 LPELSSDLVAALTSLDMYDFPHFVLFM 76 L E + +L AL+S++ F HFVL M Sbjct: 870 LVEFALELKKALSSINEQSFNHFVLKM 896 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 366 EDEVVRTEDLSERSRADRVHGAGLQVDED 280 ED + L SR VH G Q D D Sbjct: 1411 EDSTRDSTKLDRSSREREVHNGGQQEDRD 1439 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,351 Number of Sequences: 438 Number of extensions: 2957 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -