BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G18 (434 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 22 2.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 2.2 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 20 8.9 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 20 8.9 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 22.2 bits (45), Expect = 2.2 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 138 EPRTDFVQLQLTEWSIRFSIVACRXVRPMYSRII-LLGVIT 19 E R DF++L + + + I ACR + S I+ LL IT Sbjct: 182 EARDDFIKLGIKLSNDKLEITACRLFKIDNSLILDLLVFIT 222 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 2.2 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = -3 Query: 285 GIEEDHAANE*LIEWSHANLLRLYVLMLPSPXGSTESSGHGRRSLAAATEPRTD 124 GI+E + L++ NLLR Y G E SG S++ R + Sbjct: 769 GIDESVDYTKPLVDAQTMNLLRSYHQQQSHHYGRRERSGSESSSISERCSSRVE 822 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 20.2 bits (40), Expect = 8.9 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 375 LYFNSYSNRYRXC 337 + FN YS+ Y C Sbjct: 72 MVFNDYSSEYEKC 84 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 20.2 bits (40), Expect = 8.9 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 22 DYPKEYNPAVH 54 +YPKE+N +H Sbjct: 98 NYPKEWNKILH 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,316 Number of Sequences: 336 Number of extensions: 1670 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9670396 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -