BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G18 (434 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC61.05 |||S. pombe specific multicopy membrane protein family... 25 3.8 SPBC651.06 |mug166||sequence orphan|Schizosaccharomyces pombe|ch... 24 8.8 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 24 8.8 >SPCC61.05 |||S. pombe specific multicopy membrane protein family 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 469 Score = 25.4 bits (53), Expect = 3.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 155 LRLPWPELSVEPXGD 199 +R+PWP L+VE GD Sbjct: 174 IRIPWPVLTVEFYGD 188 >SPBC651.06 |mug166||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 234 Score = 24.2 bits (50), Expect = 8.8 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -3 Query: 180 ESSGHGRRSLAAATEPRTDFVQLQLTEWSIRFSIVACRXVRPMY 49 ESS HG SL A +P T V L W+ +F+ R Y Sbjct: 24 ESSAHGDASLGQADKPLTVDV---LDAWTTQFTKKQTRVFHEAY 64 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 24.2 bits (50), Expect = 8.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 97 PFSQLKLNEIGSWFGRRSXTPSAVA 171 P ++L ++ S+F RRS P ++A Sbjct: 595 PLKLIQLGKLSSYFVRRSFVPYSIA 619 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,607,731 Number of Sequences: 5004 Number of extensions: 28175 Number of successful extensions: 68 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -