BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G16 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 3.1 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 5.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.1 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 3.1 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -3 Query: 283 LQIFIKFVEAVYHRAKVFLNSLRGQGGFNFFPQFLNCFLRTL 158 L IF +E V FL ++ GQG FN N L T+ Sbjct: 247 LVIFDCCLETVSALNGAFLYTINGQGQFNIEMFLCNMSLLTV 288 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 5.4 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 200 ESALAPETVKKNFGTMVDSFN 262 + LA T+K+NF T ++ N Sbjct: 686 DELLAQPTIKENFHTALEIMN 706 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 5.4 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 128 KEDNSLNTLAESAKKTIEELREKVES 205 K DN N ++++ +L K+ES Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIES 1118 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 5.4 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 128 KEDNSLNTLAESAKKTIEELREKVES 205 K DN N ++++ +L K+ES Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIES 1118 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.6 bits (41), Expect = 7.1 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 395 HRKLLFNNVENIITFDIFGVMYLDTKKLLLRLSVLPR 285 HRK + ++ I+ FDI ++ KK + V+ R Sbjct: 1179 HRKKIVKFLDGIMAFDIQLKQVVNYKKKKFQRMVVAR 1215 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,340 Number of Sequences: 336 Number of extensions: 1790 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -