BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G16 (450 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosac... 28 0.76 SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 27 1.0 SPCC1739.06c |||uroporphyrin methyltransferase |Schizosaccharomy... 26 3.1 SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyce... 26 3.1 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 25 4.1 SPAC1F12.06c |||endonuclease |Schizosaccharomyces pombe|chr 1|||... 25 4.1 SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizo... 25 5.4 SPAC959.03c |||U3 snoRNP-associated protein Utp7|Schizosaccharom... 25 5.4 SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces po... 25 7.1 SPAC29A4.06c |||human CCDC55 homolog|Schizosaccharomyces pombe|c... 25 7.1 SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|c... 25 7.1 SPAC23H3.10 |ssr2||SWI/SNF and RSC complex subunit Ssr2|Schizosa... 24 9.4 SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe... 24 9.4 >SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 27.9 bits (59), Expect = 0.76 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 98 VHAFVKRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGT 244 V A +K+D +E S L TIE+L+ K E+ P K F + Sbjct: 128 VQALIKQDFEREHTSPPELPTKLVNTIEKLKVKEENEAPPVIPAKPFSS 176 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 27.5 bits (58), Expect = 1.0 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = -1 Query: 216 GAKADSTFSLNSSIVFFALSASVFRLLSSLGASRLTNACTLARQIANKIISSLFILD 46 G A + F ++ SIV+ A+ ++V + + A ++ NK+ S L++LD Sbjct: 410 GYMAITKFEVSQSIVYSAIVSAVAEFIRQILAEDQLLLNNFFEELKNKLESDLYLLD 466 >SPCC1739.06c |||uroporphyrin methyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 496 Score = 25.8 bits (54), Expect = 3.1 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 186 NSSIVFFALSASVFRLLSSLGASRLTNACTLARQIANKIISSL 58 N S+ F L A+ + S +N C LA+++ ++SSL Sbjct: 121 NPSLCSFTLPATWSEPPLQISLSTSSNGCRLAQRLLRHVVSSL 163 >SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyces pombe|chr 2|||Manual Length = 292 Score = 25.8 bits (54), Expect = 3.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 232 KLWHDGRQLQRIL*KSEARGSTESL-RSNFLVSKYITPN 345 K W DGR+ RIL ++E R S ++ RSN +Y N Sbjct: 216 KKWSDGRR-DRILKQAEERRSNRAVGRSNLSGREYFESN 253 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 25.4 bits (53), Expect = 4.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 KEDNSLNTLAESAKKTIEELREKVESAL 211 KE NS++ L+ S +KTIE R + S + Sbjct: 371 KEKNSISELSPSLQKTIEWARVNLASTI 398 >SPAC1F12.06c |||endonuclease |Schizosaccharomyces pombe|chr 1|||Manual Length = 252 Score = 25.4 bits (53), Expect = 4.1 Identities = 16/75 (21%), Positives = 36/75 (48%) Frame = -3 Query: 382 YSIMSRTLLHSIYLGLCT*ILKNYFSGFRCFRGLQIFIKFVEAVYHRAKVFLNSLRGQGG 203 Y + R +++ YL + + ++Y GF FR ++ ++ + + H+ ++ + + G G Sbjct: 60 YDLEQRMIIYKDYLCIEK-LEEDYVPGFLSFREIKWYLPLLNHIPHQFRIDIILVDGNGV 118 Query: 202 FNFFPQFLNCFLRTL 158 + L C L L Sbjct: 119 LHPVGFGLACHLGVL 133 >SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.0 bits (52), Expect = 5.4 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +1 Query: 307 RSNFLVSKYITPNISNVIMFSTLLNKS 387 ++ L ++ TPN SNV + ++L+N+S Sbjct: 505 KNTILSNENNTPNYSNVCLSTSLINRS 531 >SPAC959.03c |||U3 snoRNP-associated protein Utp7|Schizosaccharomyces pombe|chr 1|||Manual Length = 520 Score = 25.0 bits (52), Expect = 5.4 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +2 Query: 104 AFVKRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEF 268 + K + EDN AE ++T + ++++ +A ET K+F +D F + Sbjct: 51 SLAKTEILHEDNPGLLEAEGLERTYKFRQDQLAPNVALETATKSFSLDLDKFGGY 105 >SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 24.6 bits (51), Expect = 7.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 125 PKEDNSLNTLAESAKKTIEELREKVESA 208 PKED +T+ E +K I EKV+ A Sbjct: 65 PKEDALYSTIREEYQKAINIQNEKVQLA 92 >SPAC29A4.06c |||human CCDC55 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 355 Score = 24.6 bits (51), Expect = 7.1 Identities = 14/68 (20%), Positives = 30/68 (44%), Gaps = 7/68 (10%) Frame = +2 Query: 110 VKRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKK-------NFGTMVDSFNEF 268 +K+ P E ++ T E + E+ + ++ + + N+ + F+EF Sbjct: 13 MKKKKPNESSNRITFTEDDSSSSEQEHAPIPNSFSSQITAASDASKDDNYDASIYGFDEF 72 Query: 269 YKNLKPAE 292 Y ++K AE Sbjct: 73 YDSMKSAE 80 >SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1316 Score = 24.6 bits (51), Expect = 7.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 13 SCSRFVKTFSNIQNEQAADYLVGYLPRQC 99 +C ++F N+ +D LVG+LPR C Sbjct: 596 ACVSNYRSFINVTAR--SDVLVGFLPRSC 622 >SPAC23H3.10 |ssr2||SWI/SNF and RSC complex subunit Ssr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 503 Score = 24.2 bits (50), Expect = 9.4 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +2 Query: 107 FVKRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNLK 283 FVK + SLN + +++ K +E +KV P K F V+ +Y NLK Sbjct: 156 FVKLEEKHYSPSLNAMEQTSPKEEDEKSDKV-----PRVDKVCFTCGVNCSQTWYHNLK 209 >SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 721 Score = 24.2 bits (50), Expect = 9.4 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +2 Query: 164 AKKTIEELREKVESALAPETVK-KNFGTMVDSFNEFYKNL 280 A+K IEE E E A A E ++ +NF T V+ E +K L Sbjct: 418 AEKAIEEAAE-AERAEADERLRLENFSTWVNEKRETHKIL 456 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,602,291 Number of Sequences: 5004 Number of extensions: 30573 Number of successful extensions: 120 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -