BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G16 (450 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07777.1 68415.m00893 expressed protein 30 0.63 At3g28180.1 68416.m03521 glycosyl transferase family 2 protein s... 29 1.9 At1g73090.1 68414.m08451 expressed protein 28 2.5 At3g21510.1 68416.m02714 two-component phosphorelay mediator 3 (... 28 3.4 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 27 4.4 At3g57060.1 68416.m06353 non-SMC condensin subunit, XCAP-D2/Cnd1... 27 4.4 At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ... 27 4.4 At5g58720.1 68418.m07356 PRLI-interacting factor, putative simil... 27 5.9 At1g21240.1 68414.m02654 wall-associated kinase, putative simila... 27 5.9 At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF... 27 7.7 >At2g07777.1 68415.m00893 expressed protein Length = 262 Score = 30.3 bits (65), Expect = 0.63 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -1 Query: 255 LSTIVPKFFLTVSGAKADSTFSLNSSIVFFALSASVFRLLSSLGASRLTNACTLA 91 LS+ V FF G+++ S F+L ++ S +FR L R+T C LA Sbjct: 11 LSSSVAGFFGRFLGSESVSRFNLIIFLILLVFSICLFRSLKQYLGKRMTQWCYLA 65 >At3g28180.1 68416.m03521 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 673 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = +2 Query: 122 APKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNL 280 A KE+ +ES + + +L+E+ + + ETVKK+ G ++ N+ N+ Sbjct: 570 AEKEEKLHRRNSESGLELLSKLKEQETNLVGQETVKKSLGGLMRPKNKKKTNM 622 >At1g73090.1 68414.m08451 expressed protein Length = 306 Score = 28.3 bits (60), Expect = 2.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 208 LGPGDC*EKLWHDGRQLQRI 267 +GPG C + W +GR+LQ++ Sbjct: 272 IGPGVCVGQAWQEGRELQQV 291 >At3g21510.1 68416.m02714 two-component phosphorelay mediator 3 (HP3) identical to ATHP3 [Arabidopsis thaliana] GI:4156245 Length = 154 Score = 27.9 bits (59), Expect = 3.4 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -1 Query: 255 LSTIVPKFFLTVSGAKADSTFSLNSSIVFFA-LSASVFRLL---SSLGASRLTNACTLAR 88 +S +V FF D + SL+ +V F + V +L SS+GA R+ NAC + R Sbjct: 42 VSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFR 101 Query: 87 QIANK 73 + Sbjct: 102 SFCEQ 106 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 27.5 bits (58), Expect = 4.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 98 VHAFVKRDAPKEDNSLNTLAESAKKTIEELREKVESA 208 VH KRD+ + L ESA++ ++EL + + S+ Sbjct: 563 VHEAHKRDSSSQVKELEARVESAEEQVKELNQNLNSS 599 >At3g57060.1 68416.m06353 non-SMC condensin subunit, XCAP-D2/Cnd1 family protein similar to 13S condensin XCAP-D2 subunit [Xenopus laevis] GI:3764087; contains Pfam profile PF04594: Non-SMC condensin subunit, XCAP-D2/Cnd1 Length = 1439 Score = 27.5 bits (58), Expect = 4.4 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 140 SLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYK 274 SL T E K + E + E ALA + V +NF ++++ +F K Sbjct: 1171 SLLTFTEKGIKKLIESFKSYEHALAEDLVTENFRSIINKGKKFAK 1215 >At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ribosomal protein L24, Arabidopsis thaliana, EMBL:AC006282 Length = 163 Score = 27.5 bits (58), Expect = 4.4 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 116 RDAPKEDNSLNTLAESAKKTIEELR-EKVESALAPETVKKNF 238 RDA +E +L + E KKT +E + +KVE A + VK NF Sbjct: 104 RDAAREA-ALREIKERIKKTKDEKKAKKVEFASKQQKVKANF 144 >At5g58720.1 68418.m07356 PRLI-interacting factor, putative similar to PRLI-interacting factor N [Arabidopsis thaliana] GI:11139276; contains Pfam profile PF01713: Smr domain Length = 519 Score = 27.1 bits (57), Expect = 5.9 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = +2 Query: 113 KRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNLKPAE 292 KR + + T ++ KK +EE R+ E E V KNF ++S E + ++ E Sbjct: 12 KRSCAAKPSGDGTTSDGNKKDVEEERKDGEGKREIENVGKNF---IESLMEAFCSVSMEE 68 Query: 293 APKA 304 A A Sbjct: 69 AMAA 72 >At1g21240.1 68414.m02654 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 741 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 225 TVSGAKADSTFSLNSSIVFFALSASVFRLLSSLGASRLTNAC 100 T G + S+FSL+S+ F + + LLS+ G + C Sbjct: 105 TALGYQLGSSFSLSSNNKFTLVGCNALSLLSTFGKQNYSTGC 146 >At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF) identical to alpha-glucosidase I (GI:16506680, GI:13398928) [Arabidopsis thaliana] Length = 852 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 69 LSCWLSASPMCMHSSNEMLLKK 134 L CW+ + CMHS E+L K+ Sbjct: 603 LRCWMYLAADCMHSITELLGKE 624 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,041,461 Number of Sequences: 28952 Number of extensions: 151009 Number of successful extensions: 473 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -