BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G15 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0604 - 16132173-16132391,16132488-16132556,16132824-161328... 46 3e-05 07_03_1529 + 27491963-27492465,27493045-27493154,27493384-274935... 42 3e-04 07_01_1036 + 9021395-9021658,9024214-9024690 42 6e-04 08_02_1301 - 25977012-25978037 39 0.004 10_08_0053 - 14496494-14497240,14497418-14497501,14497676-14498152 38 0.005 10_08_0051 + 14489255-14490403 38 0.005 08_02_1308 - 26024491-26025405 38 0.005 08_02_1310 - 26037025-26038074 37 0.016 06_01_1008 - 7853089-7854147 37 0.016 04_04_1221 + 31845938-31847038 36 0.028 10_08_0052 - 14491990-14493108 36 0.037 08_02_1304 - 26008105-26009070 36 0.037 08_02_1251 - 25592537-25593380,25593589-25593893 36 0.037 05_04_0228 - 19224901-19224991,19225095-19225219,19225293-192254... 36 0.037 08_01_0027 - 195321-195932,197206-197415 35 0.065 10_08_0055 - 14505747-14506934 34 0.086 10_08_0119 - 14952786-14953931,14954709-14954831 34 0.11 08_01_0801 - 7750548-7751708 34 0.11 08_01_0797 + 7711772-7712869 34 0.11 08_01_0200 + 1632883-1633913,1634620-1634677 34 0.11 12_01_0252 + 1868670-1869200,1870167-1871120 31 0.13 11_01_0252 + 1934505-1935032,1936001-1936957 31 0.13 08_02_1121 + 24457413-24457528,24458395-24458552,24458927-244590... 33 0.20 07_01_0011 - 81696-81892,83345-83621,83841-84189,84280-84644 33 0.20 08_01_0803 - 7771507-7772184,7772238-7772325,7772440-7772546 33 0.26 04_03_0991 - 21500143-21500799,21500834-21501172 33 0.26 09_02_0037 + 3251066-3251086,3251143-3251151,3251249-3251436,325... 32 0.35 08_02_1303 - 26006294-26006513,26006576-26007318 32 0.35 08_01_0657 + 5674907-5674993,5675615-5676583 32 0.35 04_04_1223 + 31851545-31852609,31854314-31854773,31856201-318562... 32 0.35 10_08_0082 + 14713989-14714046,14714109-14714953 32 0.46 08_02_1302 - 25990378-25991457 31 0.61 10_08_0129 - 15025076-15025858,15025951-15026283 31 1.1 10_08_0122 - 14982676-14983043,14983957-14985145 31 1.1 08_01_0199 + 1628158-1629192 31 1.1 04_03_0990 - 21481459-21481933,21482140-21482771 31 1.1 01_07_0176 - 41733845-41734834,41736058-41736588 31 1.1 10_08_0087 + 14730936-14732027 30 1.9 10_08_0054 + 14501357-14502478 30 1.9 04_03_0994 - 21514495-21515610 30 1.9 03_05_0727 - 27170082-27170336,27170398-27170793,27171009-27171014 30 1.9 10_08_0118 + 14948636-14949667,14949893-14949953,14951226-14951977 29 2.4 08_01_0802 - 7754561-7755628 29 2.4 10_08_0073 + 14657400-14657696,14658168-14658229,14658241-14658886 29 3.2 02_04_0471 + 23192001-23192102,23192229-23192356,23192440-231931... 29 3.2 11_06_0430 - 23413909-23413978,23414078-23414159,23414538-234146... 29 4.3 10_08_0125 - 15000650-15001717 29 4.3 10_08_0124 + 14992399-14993478 29 4.3 08_02_1305 - 26013022-26014107 29 4.3 08_01_0203 + 1639993-1641141 29 4.3 06_03_1064 - 27300735-27301829 29 4.3 04_04_0804 + 28171110-28171176,28171829-28172317,28172384-28173072 28 5.6 10_08_0076 + 14685364-14686468,14686521-14686540,14686614-146867... 27 9.9 >05_03_0604 - 16132173-16132391,16132488-16132556,16132824-16132898, 16132981-16133113,16133188-16133297,16133360-16133407, 16133657-16133983,16135006-16135233,16135360-16135689, 16135780-16136586 Length = 781 Score = 46.0 bits (104), Expect = 3e-05 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +1 Query: 262 VXVTLAAEGRLLQAHKLXLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMY 435 V + + G + AHKL LS+ S F +MF M + VF +DV A L+QFMY Sbjct: 352 VNIYVNGHGLVTHAHKLILSLWSMTFDKMFTNGMKESSASNVFFEDVPVEAFFLLIQFMY 411 Query: 436 QGEVNVKQEEL 468 GE+ V EE+ Sbjct: 412 SGELKVDIEEI 422 >07_03_1529 + 27491963-27492465,27493045-27493154,27493384-27493510, 27494082-27494430,27494975-27495251,27496236-27496333, 27498090-27498214,27498270-27498326,27498328-27498370, 27498581-27498667,27498802-27498882,27499735-27499901, 27499987-27500098,27500188-27500390,27500473-27500607, 27501106-27501205 Length = 857 Score = 42.3 bits (95), Expect = 3e-04 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 2/80 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF-KMNPTQHPIVFL 387 +NMS LL+ G +T +G + AHK+ L+ SP F+ ++F M + + Sbjct: 295 SNMSQHIGQLLTDGKRTDITFEVDGEVFPAHKVVLAARSPVFRAQLFGPMKDKNMKRITI 354 Query: 388 KDVSHSALRDLLQFMYQGEV 447 +D+ S + LL FMY E+ Sbjct: 355 EDMEASVFKALLHFMYWDEL 374 >07_01_1036 + 9021395-9021658,9024214-9024690 Length = 246 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Frame = +1 Query: 301 AHKLXLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELXS 474 AH++ L+ SP F+ M + M ++ I+ + DVS+ LR + +MY E + ++ Sbjct: 83 AHRVILASRSPVFRAMLENEMEESRSGIIKIYDVSYDVLRAFVHYMYTAEALLDEQMASD 142 Query: 475 FISTAEQLQVKGL 513 + AE+ +VK L Sbjct: 143 LLVLAEKYEVKNL 155 >08_02_1301 - 25977012-25978037 Length = 341 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQE--MFKMNPTQHPIVFL 387 +N+ G++ R D V+ + G AH+ L+ SP F+ + M P V L Sbjct: 155 SNLGGQLGGIVDRADCSDVSFSVGGETFHAHRAVLAARSPVFKAELLGSMAEAAMPCVTL 214 Query: 388 KDVSHSALRDLLQFMY 435 D+ + + LL F+Y Sbjct: 215 HDIDPATFKALLHFVY 230 >10_08_0053 - 14496494-14497240,14497418-14497501,14497676-14498152 Length = 435 Score = 38.3 bits (85), Expect = 0.005 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Frame = +1 Query: 238 GLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF---KMNPTQHPIVFLKDVSHS 405 GLL GD VT G + AH+ L+ SP F+ E+F K + + + IV + D+ Sbjct: 252 GLLESGDGADVTFHVAGEEVPAHRYILAARSPVFKAELFGQMKESSSSNTIVKVDDMEAE 311 Query: 406 ALRDLLQFMY 435 R LL F+Y Sbjct: 312 VFRALLAFIY 321 >10_08_0051 + 14489255-14490403 Length = 382 Score = 38.3 bits (85), Expect = 0.005 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = +1 Query: 238 GLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF---KMNPTQHPIVFLKDVSHS 405 GLL GD VT G ++AH+ L+ SP F+ E+F K + + + +V + D+ Sbjct: 192 GLLESGDGADVTFHVAGEEVRAHRYILAARSPVFKAELFGQMKESSSSNTVVNVDDMEAE 251 Query: 406 ALRDLLQFMY 435 R LL F+Y Sbjct: 252 VFRALLVFIY 261 >08_02_1308 - 26024491-26025405 Length = 304 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 2/76 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQE--MFKMNPTQHPIVFL 387 +++ A GLL RG+ V+ +G AH+ L+ SP F+ + M ++ + L Sbjct: 112 SDIGAHLGGLLDRGEGTDVSFLVDGETFPAHRAVLAARSPVFRAELLGSMAESKMSSITL 171 Query: 388 KDVSHSALRDLLQFMY 435 D+ R LL+F+Y Sbjct: 172 HDIEPLTFRALLRFIY 187 >08_02_1310 - 26037025-26038074 Length = 349 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +1 Query: 256 DLVXVTLAAEGRLLQAHKLXLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 429 D V L G +AH+ L+ SP F+ M P V L+D+ +A R +L F Sbjct: 177 DTADVALVVGGETFRAHRAVLAARSPVFKAALFGSMAEATAPSVALRDMDPAAFRAVLHF 236 Query: 430 MYQGEVNVKQEELXSF 477 +Y + +EL F Sbjct: 237 IYTDALPDDIDELAGF 252 >06_01_1008 - 7853089-7854147 Length = 352 Score = 36.7 bits (81), Expect = 0.016 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQG 441 VT G AHK+ L+ SP F F M + V +KD+ S + +L F+Y G Sbjct: 179 VTFVVAGESFLAHKIILAARSPVFMAEFFGPMKESSSQCVEIKDIEASVFKAMLHFIYTG 238 >04_04_1221 + 31845938-31847038 Length = 366 Score = 35.9 bits (79), Expect = 0.028 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF---KMNPTQHPIV 381 +N+ F +L G+ VT G+ +AHK L+ SP F+ E+F K N TQ + Sbjct: 178 SNLHTDFENMLQDGEGSDVTFTVGGQEFRAHKCVLAFRSPVFKAELFGPMKENGTQ--CI 235 Query: 382 FLKDVSHSALRDLLQFMY 435 + D+ LL F+Y Sbjct: 236 KIDDMEPEVFEALLHFIY 253 >10_08_0052 - 14491990-14493108 Length = 372 Score = 35.5 bits (78), Expect = 0.037 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 5/71 (7%) Frame = +1 Query: 238 GLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-----EMFKMNPTQHPIVFLKDVSH 402 GLL GD VT G ++AH+ L+ SP F+ +M + + + + ++ + D+ Sbjct: 188 GLLESGDGADVTFRVAGEDVRAHRYILAARSPVFKAELFGQMKESSSSSNTVMNVDDMEA 247 Query: 403 SALRDLLQFMY 435 R LL F+Y Sbjct: 248 EVFRALLAFIY 258 >08_02_1304 - 26008105-26009070 Length = 321 Score = 35.5 bits (78), Expect = 0.037 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +1 Query: 277 AAEGRLLQAHKLXLSVCSPYFQE--MFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVN 450 A G AH+ L+ SP F+ + M P V L+D+ + R LL F+Y + Sbjct: 159 AVGGETFHAHRAVLAARSPVFRAELLGSMAEATMPCVTLRDIEPATFRALLHFVY---TD 215 Query: 451 VKQEELXSFISTAEQLQ 501 V Q E S ST + LQ Sbjct: 216 VLQIEGSSSTSTTDLLQ 232 >08_02_1251 - 25592537-25593380,25593589-25593893 Length = 382 Score = 35.5 bits (78), Expect = 0.037 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 286 GRLLQAHKLXLSVCSPYFQEMFKMNPTQHPI--VFLKDVSHSALRDLLQFMYQGE 444 G AH+ L+VCSP F+ + + + + L D+ + LL FMY G+ Sbjct: 232 GETFHAHRALLAVCSPVFKALLLSSTAEAAACSITLNDIKPAMFEALLHFMYTGD 286 >05_04_0228 - 19224901-19224991,19225095-19225219,19225293-19225410, 19225554-19225618,19225760-19225839,19225942-19226005, 19227341-19227480,19227571-19227694,19227781-19227840, 19227922-19227990,19228139-19228288,19229182-19229289, 19229573-19229648,19229960-19230054,19231729-19231803, 19231923-19232043,19232136-19232308,19232647-19232813, 19232944-19233301 Length = 752 Score = 35.5 bits (78), Expect = 0.037 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 2/87 (2%) Frame = +1 Query: 259 LVXVTLAAEGRLLQAHKLXLSVCSPYFQEMFKMNPTQHPI--VFLKDVSHSALRDLLQFM 432 L VT EG+ AH++ L S F+ MF + + + ++ + +++F+ Sbjct: 585 LSDVTFLVEGKRFYAHRIALLASSDAFRAMFDGGYREKDARDIEIPNIRWNVFELMMRFI 644 Query: 433 YQGEVNVKQEELXSFISTAEQLQVKGL 513 Y G V V + + A+Q ++GL Sbjct: 645 YTGSVEVTSDISQDLLRAADQYLLEGL 671 >08_01_0027 - 195321-195932,197206-197415 Length = 273 Score = 34.7 bits (76), Expect = 0.065 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 3/93 (3%) Frame = +1 Query: 190 SLCWNNFHANMSAG-FHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQEMF--KMN 360 S+ N + S G +L+ VT+ +L+AHK L+ CSP F+ MF + Sbjct: 83 SIAVQNIASKSSLGCLSRMLTESIHADVTINTTDGVLKAHKAILASCSPVFESMFLHDLK 142 Query: 361 PTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQ 459 + + + D+ + L+ F+Y G + + Q Sbjct: 143 EKESSTININDMCLESCSALIGFIY-GTIKLDQ 174 >10_08_0055 - 14505747-14506934 Length = 395 Score = 34.3 bits (75), Expect = 0.086 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDL-VXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF--KMNPTQHPIV 381 +++S GLL+ +L VT G AH+ L+ SP F+ E+F ++ Sbjct: 182 SDLSQHLGGLLAAKELGADVTFLVAGETFTAHRCVLAARSPVFRAELFGPMKESAATAVI 241 Query: 382 FLKDVSHSALRDLLQFMY 435 + D+ R+LL FMY Sbjct: 242 TVDDIEPDVFRNLLTFMY 259 >10_08_0119 - 14952786-14953931,14954709-14954831 Length = 422 Score = 33.9 bits (74), Expect = 0.11 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMFK-MNPTQHPIVFL 387 +NM + LLS + V G AH+L L+ SP F+ E+FK M ++ + Sbjct: 233 SNMHMDYGDLLSSKEGTDVEFVVGGETFAAHRLVLAARSPVFKAELFKPMEEGTTDVIKI 292 Query: 388 KDVSHSALRDLLQFMY 435 ++ + LL F+Y Sbjct: 293 DNMDAQVFKALLVFIY 308 >08_01_0801 - 7750548-7751708 Length = 386 Score = 33.9 bits (74), Expect = 0.11 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Frame = +1 Query: 232 FHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMFKM--NPTQHPIVFLKDVSH 402 F LL + VT G HKL L++ SP F+ E+ + P PI + D+ Sbjct: 191 FANLLQSKEGADVTFDVAGEPFSVHKLVLAMRSPVFKAELCGLLREPGTQPITIV-DMQP 249 Query: 403 SALRDLLQFMYQGEVNV 453 + R LLQF+Y + V Sbjct: 250 AVFRALLQFIYTDQFPV 266 >08_01_0797 + 7711772-7712869 Length = 365 Score = 33.9 bits (74), Expect = 0.11 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMY 435 V + EG AHKL L+ SP F+ F +M + +KD+ S R LL F+Y Sbjct: 194 VVFSVEGESFAAHKLVLAARSPVFKAEFYGEMIERGTFSIDIKDMQPSVFRALLHFIY 251 >08_01_0200 + 1632883-1633913,1634620-1634677 Length = 362 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYFQ-EMF---KMNPTQHPIVFLKDVSHSALRDLLQFMY 435 VT A +G AH+L L+ SP F+ E++ K H ++ + DV + + LL F+Y Sbjct: 180 VTFAVQGETFTAHRLMLAARSPVFKAELYGAMKEKDADH-VIAIVDVQPAVFKALLHFIY 238 Query: 436 QGEV 447 ++ Sbjct: 239 TDDM 242 >12_01_0252 + 1868670-1869200,1870167-1871120 Length = 494 Score = 31.1 bits (67), Expect(2) = 0.13 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +1 Query: 217 NMSAGFHGLLSRGDLVX-VTLAAEGRLLQAHKLXLSVCSPYFQEMF-KMNPTQHP 375 ++S + LL G V + EGRL+ AH+ L+ S +F+++F ++P P Sbjct: 9 SLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQP 63 Score = 21.4 bits (43), Expect(2) = 0.13 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +1 Query: 364 TQHPIVFLKDVSHSALRDLLQFMYQGEVNV 453 T ++ + + + L +LQF+Y G+ +V Sbjct: 100 TPELVIPVSSIRYEVLVLVLQFLYSGQASV 129 >11_01_0252 + 1934505-1935032,1936001-1936957 Length = 494 Score = 31.1 bits (67), Expect(2) = 0.13 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +1 Query: 217 NMSAGFHGLLSRGDLVX-VTLAAEGRLLQAHKLXLSVCSPYFQEMF-KMNPTQHP 375 ++S + LL G V + EGRL+ AH+ L+ S +F+++F ++P P Sbjct: 9 SLSLDYLSLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQP 63 Score = 21.4 bits (43), Expect(2) = 0.13 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +1 Query: 364 TQHPIVFLKDVSHSALRDLLQFMYQGEVNV 453 T ++ + + + L +LQF+Y G+ +V Sbjct: 99 TPELVIPVSSIRYEVLVLVLQFLYSGQASV 128 >08_02_1121 + 24457413-24457528,24458395-24458552,24458927-24459042, 24459735-24460400 Length = 351 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +1 Query: 241 LLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALR 414 +L G L +T+ A + AH+ L+ SP F+ MF + + V + D+S A + Sbjct: 179 MLQEGILTDITINATDGSIMAHRAILASRSPVFRSMFSHDLKEKELSTVDISDMSLEACQ 238 Query: 415 DLLQFMY 435 L ++Y Sbjct: 239 AFLNYIY 245 >07_01_0011 - 81696-81892,83345-83621,83841-84189,84280-84644 Length = 395 Score = 33.1 bits (72), Expect = 0.20 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQEMF---KMNPTQHPIVF 384 ++M F+ LL+ V+ +QAHK L+ SP F+ F NP H ++ Sbjct: 170 SDMGRCFNNLLNLRIGCDVSFEVGDERVQAHKWILAARSPVFKAQFFGPIGNPDLHTVI- 228 Query: 385 LKDVSHSALRDLLQFMYQGEVNVKQEELXSFIST 486 ++DV + ++ F+Y E+ EL +ST Sbjct: 229 VEDVEPLVFKAMVNFIYSDEL-PSIHELAGSVST 261 >08_01_0803 - 7771507-7772184,7772238-7772325,7772440-7772546 Length = 290 Score = 32.7 bits (71), Expect = 0.26 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF-KMNPTQHPIVFL 387 ++++A LL + VT AHK+ L++ SP F+ E+F M ++ + Sbjct: 103 SDIAAHLGKLLESKEAADVTFYVGEDTFAAHKVVLAMRSPVFKAELFGPMREAGAQVLPI 162 Query: 388 KDVSHSALRDLLQFMYQGEVNV 453 KD+ + LL F+Y +++ Sbjct: 163 KDIQPDVFKALLHFIYTDSLSI 184 >04_03_0991 - 21500143-21500799,21500834-21501172 Length = 331 Score = 32.7 bits (71), Expect = 0.26 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 10/76 (13%) Frame = +1 Query: 238 GLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF----KMNPT-----QHPIVFL 387 GLL+ G+ VT G+ AH+L L+ SP F+ E+F ++ T H + + Sbjct: 168 GLLATGEGADVTFEVSGKTFAAHRLVLAARSPVFRAELFGPSKELGATTGGAVDHTAIRI 227 Query: 388 KDVSHSALRDLLQFMY 435 D+ LL++MY Sbjct: 228 DDMEARDFEALLRYMY 243 >09_02_0037 + 3251066-3251086,3251143-3251151,3251249-3251436, 3252117-3252148,3252458-3252492,3252693-3253334 Length = 308 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +1 Query: 217 NMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQE--MFKMNPTQHPIVFLK 390 N++ ++ R D V + G + AH L+ SP F+ + M + P V L Sbjct: 122 NLNGQLGDIVDRADGSDVPFSVGGEMFHAHHAVLAARSPVFKTELLGSMAESAMPCVTLH 181 Query: 391 DVSHSALRDLLQFMY 435 ++ + + LL F+Y Sbjct: 182 NIDPATFKALLHFVY 196 >08_02_1303 - 26006294-26006513,26006576-26007318 Length = 320 Score = 32.3 bits (70), Expect = 0.35 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 2/75 (2%) Frame = +1 Query: 217 NMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYF--QEMFKMNPTQHPIVFLK 390 N+ A + D + A G AH+ L+ SP F Q + M P V L Sbjct: 151 NLGAQLGAMGGSADGSDASFAVGGETFHAHRAVLAARSPVFRAQLLGSMAEATMPCVTLH 210 Query: 391 DVSHSALRDLLQFMY 435 D+ + + LL F+Y Sbjct: 211 DIEPATFKALLHFVY 225 >08_01_0657 + 5674907-5674993,5675615-5676583 Length = 351 Score = 32.3 bits (70), Expect = 0.35 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = +1 Query: 241 LLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF-KMNPTQHPIVFLKDVSHSALR 414 LL RG VTL G+ AH+ L+ SP F +F M V ++D+ Sbjct: 178 LLRRGTGADVTLVVSGKCFPAHRAILASRSPVFMASLFGDMKEKSSRSVEIRDIEPQVFG 237 Query: 415 DLLQFMYQGEV 447 +L F+Y V Sbjct: 238 AMLGFIYTDSV 248 >04_04_1223 + 31851545-31852609,31854314-31854773,31856201-31856250, 31856333-31856463,31856569-31856665,31856759-31856950, 31857121-31857123 Length = 665 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYF--QEMFKMNPTQHPIVFLKDVSHSALRDLLQFMY 435 V GR+L+AH+ L+ SP F + + M T P + + V +A LL+F+Y Sbjct: 196 VAFRVGGRVLRAHRCVLAARSPVFDAELLGPMMETTAPCIEIHGVEPAAFEALLRFVY 253 >10_08_0082 + 14713989-14714046,14714109-14714953 Length = 300 Score = 31.9 bits (69), Expect = 0.46 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 4/70 (5%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYFQE----MFKMNPTQHPIVFLKDVSHSALRDLLQFMY 435 V G+ L AH+ L+ SP F+ + K T V ++D+ + LL+FMY Sbjct: 132 VVFEVGGQTLAAHRCVLAARSPVFKAELYGLMKEGGTAAGAVHIEDIEPRVFKVLLRFMY 191 Query: 436 QGEVNVKQEE 465 + +EE Sbjct: 192 TDSLPEMEEE 201 >08_02_1302 - 25990378-25991457 Length = 359 Score = 31.5 bits (68), Expect = 0.61 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 2/76 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF-KMNPTQHPIVFL 387 +N+ ++ D V+ + G AH+ L+ SP F+ E+ P V L Sbjct: 165 SNLGGQLGAMVGSADGSDVSFSVGGETFHAHRAVLAARSPVFRVELLGSTAEATMPCVTL 224 Query: 388 KDVSHSALRDLLQFMY 435 D+ + R LL F+Y Sbjct: 225 HDIEPTTFRALLHFVY 240 >10_08_0129 - 15025076-15025858,15025951-15026283 Length = 371 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 5/89 (5%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYF-QEMF---KMNPTQHPIV 381 ++M + LLS V G AH+L L+V SP F E F K + ++ Sbjct: 151 SDMHLHYGDLLSSKRCADVEFLVGGETFAAHRLVLAVRSPVFVAEHFGPMKEGVNVNDVI 210 Query: 382 FLKDVSHSALRDLLQFMYQGE-VNVKQEE 465 + D+ + LL F+Y + + QEE Sbjct: 211 EINDMDAQVFKALLNFIYTDTLLEMDQEE 239 >10_08_0122 - 14982676-14983043,14983957-14985145 Length = 518 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 5/89 (5%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYF-QEMF---KMNPTQHPIV 381 ++M + LLS V G AH+L L+V SP F E F K + ++ Sbjct: 179 SDMHLHYGDLLSSKRCADVEFLVGGETFAAHRLVLAVRSPVFVAEHFGPMKEGVNVNDVI 238 Query: 382 FLKDVSHSALRDLLQFMYQGE-VNVKQEE 465 + D+ + LL F+Y + + QEE Sbjct: 239 EINDMDAQVFKALLNFIYTDTLLEMDQEE 267 >08_01_0199 + 1628158-1629192 Length = 344 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +1 Query: 241 LLSRGDLVX--VTLAAEGRLLQAHKLXLSVCSPYFQEMFKMNPTQH--PIVFLKDVSHSA 408 LL R D V VT G+ AH++ L++ SP F + +H P + + D+ Sbjct: 190 LLERADGVGADVTFDVRGQPFAAHRIVLAMRSPVFMASLYGSMREHRAPRIAVDDMEPEV 249 Query: 409 LRDLLQFMY 435 LL+F+Y Sbjct: 250 FDALLRFVY 258 >04_03_0990 - 21481459-21481933,21482140-21482771 Length = 368 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 238 GLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ 342 GLL+ G+ VT EG+ AH+ L+ SP F+ Sbjct: 188 GLLATGEGADVTFEVEGKTFAAHRWVLAARSPVFR 222 >01_07_0176 - 41733845-41734834,41736058-41736588 Length = 506 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 217 NMSAGFHGLLSRGDLVX-VTLAAEGRLLQAHKLXLSVCSPYFQEMF 351 ++S + LL G VT + EGRL+ AH+ L+ S +F++ F Sbjct: 7 SLSMDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF 52 >10_08_0087 + 14730936-14732027 Length = 363 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 4/88 (4%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMFKM--NPTQHPIVF 384 ++M+ F LL V L G+ AH+ L+ SP F+ E++ + +V Sbjct: 178 SDMNQQFGDLLETEKGADVVLEVGGQTFAAHRCVLAARSPVFRAELYGLMKEGDTAGVVC 237 Query: 385 LKDVSHSALRDLLQFMYQGEV-NVKQEE 465 ++++ + LL+F+Y + +K+EE Sbjct: 238 IEEMEAQVFKVLLRFLYTDSLPEMKEEE 265 >10_08_0054 + 14501357-14502478 Length = 373 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 6/76 (7%) Frame = +1 Query: 238 GLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF-----KMNPTQHPIVFLKDVS 399 GLL + VT G + AH+ L+ SP F+ E+F ++ + +V + D+ Sbjct: 190 GLLESMEGADVTFHVAGEEVPAHRSVLAARSPVFRAELFGAMKESVSGGSNAVVEVDDME 249 Query: 400 HSALRDLLQFMYQGEV 447 R LL F+Y E+ Sbjct: 250 ADVFRALLAFVYTDEL 265 >04_03_0994 - 21514495-21515610 Length = 371 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 238 GLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYF-QEMFKM 357 GLL+ G VT +G+ AH+ L+ SP F QE+F + Sbjct: 190 GLLATGVGADVTFEVDGKTFLAHRNVLAARSPVFHQELFSL 230 >03_05_0727 - 27170082-27170336,27170398-27170793,27171009-27171014 Length = 218 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF-KMNPTQHPIVFL 387 +N++ + R D V + AH+ L+ SP F+ E+ M + P V L Sbjct: 49 SNLNGQLDDIADRADGSDVLFSVGSETFHAHRAVLAARSPVFKMELLGSMAESTMPCVTL 108 Query: 388 KDVSHSALRDLLQFMY 435 ++ + + LL F+Y Sbjct: 109 HNIDPATFKALLHFVY 124 >10_08_0118 + 14948636-14949667,14949893-14949953,14951226-14951977 Length = 614 Score = 29.5 bits (63), Expect = 2.4 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMFKMNPTQH---PIV 381 +NM F LL + V G + AH+L L+ SP F+ E+F PT+ ++ Sbjct: 174 SNMHLHFVDLLVSKEGTDVKFLVGGEMFAAHRLVLAARSPVFKAELF--GPTKKGTIDVI 231 Query: 382 FLKDVSHSALRDLLQFMY 435 + ++ + LL F+Y Sbjct: 232 QIDNMEARVFKALLDFIY 249 >08_01_0802 - 7754561-7755628 Length = 355 Score = 29.5 bits (63), Expect = 2.4 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 2/76 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQEMF--KMNPTQHPIVFL 387 +NM LL + V G AHKL L++ SP F+ M + + + Sbjct: 179 SNMMQQLGDLLESKEGADVVFDVAGETFPAHKLVLAMRSPVFKAELCGPMRESGTEPISI 238 Query: 388 KDVSHSALRDLLQFMY 435 D+ + LLQF+Y Sbjct: 239 VDMQPVVFKALLQFIY 254 >10_08_0073 + 14657400-14657696,14658168-14658229,14658241-14658886 Length = 334 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYFQ-EMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQ 438 V G AH+ L+ SP F E+F + + +V + D+ + LL+FMY Sbjct: 163 VVFGVGGETFAAHRCVLAAQSPVFSAELFGPMKDSDRAGVVRIDDMEAQVFKALLRFMYT 222 Query: 439 GEVNVKQEE 465 + +EE Sbjct: 223 DSLPEMEEE 231 >02_04_0471 + 23192001-23192102,23192229-23192356,23192440-23193108, 23193900-23194086 Length = 361 Score = 29.1 bits (62), Expect = 3.2 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +1 Query: 220 MSAGFHGL-LSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQEMFKMNPTQHPIVFLKDV 396 +S F L S D+ VT A+G ++AH L+ SP + M + P + +V + Sbjct: 3 LSTAFSALPTSPADVRVVT--ADGSGIRAHSSVLASASPVLERMIEQAP-RGGVVPIAGA 59 Query: 397 SHSALRDLLQFMYQGEV 447 S A+ L+F+Y V Sbjct: 60 STGAVVVFLRFLYAASV 76 >11_06_0430 - 23413909-23413978,23414078-23414159,23414538-23414604, 23416186-23416647 Length = 226 Score = 28.7 bits (61), Expect = 4.3 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 2/90 (2%) Frame = +1 Query: 241 LLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYF-QEMF-KMNPTQHPIVFLKDVSHSALR 414 LLS G +T+ AH+ L+ SP F E+F M + + D+ Sbjct: 8 LLSGGHGADITVQVGDETFAAHRCVLAARSPVFTAELFGPMGQNNKETIHVHDMEPRVFE 67 Query: 415 DLLQFMYQGEVNVKQEELXSFISTAEQLQV 504 +L F+Y ++ +E+ ++ A+ L V Sbjct: 68 AMLHFIYND--SLPKEDDDEVVAMAQHLLV 95 >10_08_0125 - 15000650-15001717 Length = 355 Score = 28.7 bits (61), Expect = 4.3 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMFKMNPTQH---PIV 381 +NM F LL + V G + AH+L L+ SP F+ E+F PT+ + Sbjct: 159 SNMHLYFGDLLVSKEGTDVKFLVGGEMFAAHRLVLAARSPVFKAELF--GPTKKGTIDAI 216 Query: 382 FLKDVSHSALRDLLQFMY 435 + ++ + LL+F+Y Sbjct: 217 QIDNMEARVFKALLEFIY 234 >10_08_0124 + 14992399-14993478 Length = 359 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMFK-MNPTQHPIVFL 387 +NM + LLS + + G AH+L L+ S F+ E+F+ M ++ + Sbjct: 171 SNMHLDYGDLLSSKEGTDIEFVVRGETFAAHRLVLAARSLVFKAELFRPMEGGTTDVIKI 230 Query: 388 KDVSHSALRDLLQFMY 435 ++ + LL F+Y Sbjct: 231 DNMDAQVFKALLVFIY 246 >08_02_1305 - 26013022-26014107 Length = 361 Score = 28.7 bits (61), Expect = 4.3 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 8/85 (9%) Frame = +1 Query: 217 NMSAGFHGLLSR---GDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-EMF--KMNPT--QH 372 N+ GLL D+ V + G AH+ L+ SP F+ E+F K T Sbjct: 168 NIGVHLGGLLDSEDGADVTFVVVGGGGERFAAHRAVLAARSPVFRTELFGCKSESTSPSS 227 Query: 373 PIVFLKDVSHSALRDLLQFMYQGEV 447 + L+ + + R LL+F+Y E+ Sbjct: 228 SCITLQGIEPAIFRALLRFIYTDEL 252 >08_01_0203 + 1639993-1641141 Length = 382 Score = 28.7 bits (61), Expect = 4.3 Identities = 22/79 (27%), Positives = 32/79 (40%), Gaps = 5/79 (6%) Frame = +1 Query: 214 ANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQ-----EMFKMNPTQHPI 378 +N+ GLL VTL G AH+ L++ SP F+ M + Sbjct: 176 SNILGHLAGLLGDKGTADVTLVVRGEEFAAHRAVLAMRSPVFKAALYGPMKESTDANAGR 235 Query: 379 VFLKDVSHSALRDLLQFMY 435 V + V + R LL F+Y Sbjct: 236 VAIDSVEPAVFRALLHFIY 254 >06_03_1064 - 27300735-27301829 Length = 364 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYFQ-EMF-KMNPTQHPIVFLKDVSHSALRDLLQFMYQG 441 VT G AHK L+ SP F E+F M V +KD+ + +L F+Y Sbjct: 187 VTFVVSGESFAAHKAILASRSPVFMAELFGAMKVKASERVEVKDMEAPVFKAILHFVYTD 246 Query: 442 EV 447 V Sbjct: 247 TV 248 >04_04_0804 + 28171110-28171176,28171829-28172317,28172384-28173072 Length = 414 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 325 CSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVN-VKQEEL 468 C P + F T++P+VFL+ + + DLLQ + V+ K+ EL Sbjct: 253 CEPRKEIFFTERNTENPLVFLRFLVSTPWGDLLQIKFSRRVHRTKRLEL 301 >10_08_0076 + 14685364-14686468,14686521-14686540,14686614-14686749, 14687537-14687664,14687742-14687855 Length = 500 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = +1 Query: 268 VTLAAEGRLLQAHKLXLSVCSPYFQ-EMFKMNPTQHP--IVFLKDVSHSALRDLLQFMYQ 438 V G AH+ L+ SP F E++ + +V ++D+ + LL+FMY Sbjct: 202 VVFEVSGETFAAHRCLLAARSPVFSAELYGLMKEGDTAGVVRIEDMEAQVFKLLLRFMYT 261 Query: 439 GEVNVKQEE 465 + +EE Sbjct: 262 DSLPKMEEE 270 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,894,227 Number of Sequences: 37544 Number of extensions: 299592 Number of successful extensions: 737 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -