BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G15 (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 126 2e-31 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 109 3e-26 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 36 5e-04 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 25 0.48 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.5 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 6.0 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.0 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 126 bits (303), Expect = 2e-31 Identities = 56/116 (48%), Positives = 79/116 (68%) Frame = +1 Query: 169 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQEM 348 M + F L WNN+ +++++ F L D V VTLA +GR L+AH++ LS CSPYF+E+ Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACDGRSLKAHRVVLSACSPYFREL 60 Query: 349 FKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELXSFISTAEQLQVKGLT 516 K P +HP++ L+DV+ S L L++F+Y GEVNV Q L SF+ TAE L+V GLT Sbjct: 61 LKSTPCKHPVIVLQDVAFSDLHALVEFIYHGEVNVHQRSLSSFLKTAEVLRVSGLT 116 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 109 bits (261), Expect = 3e-26 Identities = 50/112 (44%), Positives = 76/112 (67%), Gaps = 1/112 (0%) Frame = +1 Query: 181 EQFSLCWNNFHANMSAGFHGLLSRGDLVXVTLAAEGRLLQAHKLXLSVCSPYFQEMFKMN 360 + + L WNN+ +NM++ FH LL V VTLA L+AHK+ LS CS YFQ++ N Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLACNEASLKAHKVVLSACSSYFQKLLLSN 68 Query: 361 PTQHP-IVFLKDVSHSALRDLLQFMYQGEVNVKQEELXSFISTAEQLQVKGL 513 P +HP I+ +DV + L+ +++F+Y+GE++V Q EL S + TA+QL++KGL Sbjct: 69 PCKHPTIIMPQDVCFNDLKFIIEFVYRGEIDVSQAELQSLLKTADQLKIKGL 120 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 35.5 bits (78), Expect = 5e-04 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 169 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVXVTLAAE 285 M + F L WNN+ +++++ F L D V VTLA E Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 418 LLQFMYQGEVNVKQEELXSFIS-TAEQLQVKGLTGNQNEE 534 ++ +Y G VNV+ E + S++ ++ V GN NE+ Sbjct: 43 IIDEVYNGNVNVEDENVQSYVECMMKKFNVVDENGNFNEK 82 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 536 LSSF*LPVKPLT*SCSAVLINDXNSSCLTLTSP 438 LSS P+T + S ++ N NS+C SP Sbjct: 323 LSSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSP 355 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 146 FHVESSLSWRRTNNFHY 196 + +S SWR TNN Y Sbjct: 211 YDFRNSRSWRITNNLFY 227 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 1/11 (9%) Frame = -3 Query: 599 CLCCDDL-GPG 570 C CCD+L GPG Sbjct: 13 CWCCDNLGGPG 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,750 Number of Sequences: 438 Number of extensions: 3337 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -