BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G10 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC337.15c |coq7||ubiquinone biosynthesis protein Coq7|Schizosa... 28 1.0 SPAC637.12c |mst1||histone acetyltransferase Mst1|Schizosaccharo... 27 3.1 SPAC823.04 |||rRNA processing protein, DUF947|Schizosaccharomyce... 26 5.5 SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Ma... 25 9.5 >SPBC337.15c |coq7||ubiquinone biosynthesis protein Coq7|Schizosaccharomyces pombe|chr 2|||Manual Length = 216 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 Query: 249 GVQAARPACGRARDCVAGHHLNDEFFFTVHGQNLXINFSE 368 G +AA AC A + V G H ND+ T H +N F E Sbjct: 126 GTKAAM-ACTEAVETVIGGHYNDQLRETAHLENKAPEFKE 164 >SPAC637.12c |mst1||histone acetyltransferase Mst1|Schizosaccharomyces pombe|chr 1|||Manual Length = 463 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 469 RSVTLXTRAPPSNDGIPAPPSATPSGHS 386 RS+T ++ PS P +TPSG S Sbjct: 106 RSITAPSKTEPSTPSTEKPEPSTPSGES 133 >SPAC823.04 |||rRNA processing protein, DUF947|Schizosaccharomyces pombe|chr 1|||Manual Length = 189 Score = 25.8 bits (54), Expect = 5.5 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = -2 Query: 557 RVLEGQALEDG-----DVEGSESVRQRVGSDAAPSKRHVEXARA 441 RV E Q L D D E +ES+RQ + S + +RH+E RA Sbjct: 68 RVSEIQQLRDELKICKDQERAESIRQTLKSLLSKMERHLEEERA 111 >SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Manual Length = 397 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 442 PPSNDGIPAPPSATPSGHSSSTY 374 PPS+ G PPS+ +G SS + Sbjct: 138 PPSSIGYVLPPSSLANGEGSSMF 160 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,627,386 Number of Sequences: 5004 Number of extensions: 21594 Number of successful extensions: 78 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -