BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G09 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 27 0.68 AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-tran... 24 4.8 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 8.4 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 8.4 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 8.4 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 26.6 bits (56), Expect = 0.68 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 172 IQNNNRQKKRRGGKI*IAQRTPGRRY*NLYKKILEK 279 I N N QKK+ GG + + ++Y N KK+ K Sbjct: 1564 IDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSK 1599 >AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-transferase E6 protein. Length = 227 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 528 YRQXXSQVGDTVKITIKALNL 590 Y S G V++T+KALNL Sbjct: 8 YTHTISPAGRAVELTVKALNL 28 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 8.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 549 VGDTVKITIKALNL*GPESTRTGHTLCS 632 VG V + I LNL PES R G + S Sbjct: 231 VGALVGLAILKLNLHEPESNRMGVQMLS 258 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 371 TEARAF*YIPKQSGRNNHDEYNFILT 294 T + AF Y+ + R +EY ILT Sbjct: 115 TSSEAFVYLNHELDREAREEYTLILT 140 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 8.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 460 LSKLLSIRKYFCKSSKDVVRLLKKAIQTSKQRQ 362 LS L R + + LL+KAI+TSK++Q Sbjct: 386 LSHDLEERSMAAAAHRTAKSLLEKAIRTSKRQQ 418 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 634,043 Number of Sequences: 2352 Number of extensions: 11991 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -