BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_G02 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z36949-1|CAA85415.1| 430|Caenorhabditis elegans Hypothetical pr... 30 1.6 U40270-1|AAC46954.1| 430|Caenorhabditis elegans ceOrc2p protein. 30 1.6 Z92812-7|CAB07281.2| 341|Caenorhabditis elegans Hypothetical pr... 29 2.9 AF002196-7|AAB53977.1| 254|Caenorhabditis elegans Hypothetical ... 28 6.6 >Z36949-1|CAA85415.1| 430|Caenorhabditis elegans Hypothetical protein F59E10.1 protein. Length = 430 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 38 ATLSPSFVTMPPKKQPEKSGSSGXQTRGKETGN 136 AT+ PS K PEK GS +T GKE + Sbjct: 10 ATVQPSAAVPVKKSTPEKEGSRQKKTNGKENAS 42 >U40270-1|AAC46954.1| 430|Caenorhabditis elegans ceOrc2p protein. Length = 430 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 38 ATLSPSFVTMPPKKQPEKSGSSGXQTRGKETGN 136 AT+ PS K PEK GS +T GKE + Sbjct: 10 ATVQPSAAVPVKKSTPEKEGSRQKKTNGKENAS 42 >Z92812-7|CAB07281.2| 341|Caenorhabditis elegans Hypothetical protein T03E6.8 protein. Length = 341 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -2 Query: 129 VSFPRVWXPEDPDFSGCFFGGIVTKDGESVATIVQCCHRVVDS 1 ++ PR W P F FFGGI G V++++ C V DS Sbjct: 196 IADPRQWEIYIPYFCSIFFGGICCFTG--VSSVLTCLKIVYDS 236 >AF002196-7|AAB53977.1| 254|Caenorhabditis elegans Hypothetical protein C09D4.2 protein. Length = 254 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 209 VSQNTGTCPESSCACPETSCAC 274 +S TG+ E+ CAC +CAC Sbjct: 126 LSLRTGSSNENGCACVHGNCAC 147 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,992,731 Number of Sequences: 27780 Number of extensions: 70168 Number of successful extensions: 281 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -