BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_F23 (344 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 4.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 5.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 5.4 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 4.1 Identities = 9/43 (20%), Positives = 20/43 (46%) Frame = -2 Query: 181 VLYYSYEDXYSIICQLIIXKYHKIIHNFNXRLKLNFTIWSDSV 53 ++ ++Y ++C + KI FN + FT+++ V Sbjct: 817 MIAFAYPIMLIVVCTVYAVLTRKIPEAFNESKHIGFTMYTTCV 859 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -2 Query: 166 YEDXYSIICQLIIXKYHKIIHNFNXRLKLNFTIWSDSV 53 Y +I + K KI NFN + FT+++ + Sbjct: 680 YNALLILISTVYAVKTRKIPENFNESKFIGFTMYTTCI 717 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -2 Query: 166 YEDXYSIICQLIIXKYHKIIHNFNXRLKLNFTIWSDSV 53 Y +I + K KI NFN + FT+++ + Sbjct: 770 YNALLILISTVYAVKTRKIPENFNESKFIGFTMYTTCI 807 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,743 Number of Sequences: 438 Number of extensions: 845 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7812315 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -