BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_F23 (344 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06680.1 68418.m00754 tubulin family protein similar to SP|Q9... 30 0.36 >At5g06680.1 68418.m00754 tubulin family protein similar to SP|Q96CW5 Gamma-tubulin complex component 3 {Homo sapiens} Length = 838 Score = 30.3 bits (65), Expect = 0.36 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 12 LWKXI-PNYSLSNSFTLSDHMVKFNLSLXLKLCIILW 119 +WK + PN SNSF VK L L+ C +LW Sbjct: 622 IWKTMKPNCITSNSFVKLQSSVKLQLLSALRRCQVLW 658 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,551,544 Number of Sequences: 28952 Number of extensions: 61312 Number of successful extensions: 160 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 419412672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -