BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_F09 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 27 0.68 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 26 1.2 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 2.1 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 6.3 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 8.4 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 26.6 bits (56), Expect = 0.68 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 645 RGCCTSPLPRQCCH 604 +G C P PR+CCH Sbjct: 190 QGRCFGPKPRECCH 203 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 25.8 bits (54), Expect = 1.2 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -2 Query: 332 PEAGSSPESRCASAGSNQTSRYRRIKTSGSSQWRRLQ---QTEAQSFHWCRRHGD 177 P S C + R R++ Q R+ QT +Q+ HW + HGD Sbjct: 182 PRVLESAAKFCEVLKGREMQRQFRLEQEQLQQMRKQSVDTQTLSQANHWLKSHGD 236 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 410 KHTETCEKNPLPTKDVIEQEKS 475 K+T TCE LP +DV+ + S Sbjct: 477 KNTTTCEDYALPYQDVVPSDPS 498 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = +2 Query: 239 EKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNG 382 E+T+KSL + +E ++ + +N ++A +A++ KN +G Sbjct: 148 ERTEKSLKEALEGCSQTETPVNGKRGRNLRSTEEADDAKRAKNDAPSG 195 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -3 Query: 424 RFRVLQLSGIEVLDAVQEFVLFLLRFDS 341 R ++ L +E+++ +Q+F F FD+ Sbjct: 7 RVKMFNLKRVEIMNTLQDFEEFTKSFDA 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,468 Number of Sequences: 2352 Number of extensions: 12765 Number of successful extensions: 34 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -