BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_F08 (649 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1207 + 11511754-11513865 28 5.6 09_06_0256 + 21887666-21888670 27 9.7 >07_01_1207 + 11511754-11513865 Length = 703 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 422 WISIAEELKSLNVXVTADQVXWKINALTKKYKDCID 529 W+ + +E+ L V + DQV NAL Y C D Sbjct: 324 WLRLGKEIHGLAVRMCCDQVESVSNALITMYARCKD 359 >09_06_0256 + 21887666-21888670 Length = 334 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +2 Query: 335 WTKNSTIMLLNLYXTKIHMLDNPKKKSKMWISIAEELKS 451 W+++ + LL Y K + + K K W+ IA E+ + Sbjct: 26 WSESGIVRLLEAYEAKWLLRNRAKLKWSDWVDIAHEVSA 64 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,293,052 Number of Sequences: 37544 Number of extensions: 244715 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -