BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_F06 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0640 + 25744048-25745021,25745128-25745273,25747870-257479... 28 7.5 11_01_0407 + 3090880-3092010 28 7.5 08_02_1379 - 26540012-26540587,26540804-26540995,26541777-265418... 27 9.9 >11_06_0640 + 25744048-25745021,25745128-25745273,25747870-25747945, 25747996-25748230 Length = 476 Score = 27.9 bits (59), Expect = 7.5 Identities = 20/93 (21%), Positives = 35/93 (37%) Frame = +3 Query: 333 VLVGYLCDEFPWLGDVLGARASRPHEEXADXRRSRRITVRSDIDTADVLPRACRRVRAPP 512 VL GY + + + R+S+P E AD + + D P A V + P Sbjct: 305 VLFGYSVSIYSYYTQIQTMRSSQPPSEKADAAKQELDEISGDKLEHSSSPAASTHVHSNP 364 Query: 513 TNTAT*PERNTGRXL*EQLAYPXKRSTQQTTNL 611 ++A+ + P R ++ T+L Sbjct: 365 HSSASSSAEGVAPTPAPEYLLPVARKAEKNTHL 397 >11_01_0407 + 3090880-3092010 Length = 376 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 496 AFARHLQTRLRNLSGTQDEXCESSWLTR 579 AF RH+ L +L G +DE W+ R Sbjct: 11 AFQRHVAAHLADLRGGEDELLSIEWIRR 38 >08_02_1379 - 26540012-26540587,26540804-26540995,26541777-26541812, 26542255-26542488 Length = 345 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 630 VVALSRGGWWSVELSVXSG 574 VV+L+ G WWSVEL G Sbjct: 151 VVSLASGPWWSVELGRLDG 169 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,272,783 Number of Sequences: 37544 Number of extensions: 410641 Number of successful extensions: 1016 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -