BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_F06 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21128| Best HMM Match : Arg_repressor (HMM E-Value=1.9) 30 1.4 SB_30497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 >SB_21128| Best HMM Match : Arg_repressor (HMM E-Value=1.9) Length = 381 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 306 KSVCGFRRRVLVGYLCDEFPWLGDV 380 +++ GF V +GYL DEFP G V Sbjct: 314 EAIVGFEEHVFLGYLLDEFPKKGPV 338 >SB_30497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +1 Query: 31 GRASHVYARSFARSACTGRLRVLSLSYFFISTLIRYKES 147 G+A + Y RSFAR A TG L +L I TLI E+ Sbjct: 2 GKAFYSYLRSFARGAGTGCLYLLPRQQSAIWTLIYRDET 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,734,705 Number of Sequences: 59808 Number of extensions: 467421 Number of successful extensions: 1210 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -